More
Help
About
Sign Out
No preview available
/
Fit window
Fit width
Fit height
400%
200%
100%
75%
50%
25%
View plain text
This document contains no pages.
The URL can be used to link to this page
Your browser does not support the video tag.
04/05/2022 - City Council Regular
Memo To: From: Date: Subject: Honorable Mayor and City Council Members City Administrator Miller April 1, 2022 Agenda Information for April 5, 2022 City Council Meeting ADOPT AGENDA After approval is given to the April 5, 2022 City Council agenda, the following items are in order for consideration. AGENDA EAGAN CITY COUNCIL EAGAN MUNICIPAL CENTER BUILDING April 5, 2022 6:30 P.M. I. ROLL CALL AND PLEDGE OF ALLEGIANCE II. ADOPT AGENDA III. RECOGNITIONS AND PRESENTATIONS IV. CONSENT AGENDA (Consent items are acted on with one motion unless a request is made for an item to be pulled for discussion) A. APPROVE MINUTES B. PERSONNEL ITEMS C. APPROVE Check Registers D. APPROVE Contracts E. APPROVE Fiber Optic Use Agreements with Velocity Telephone, Inc. F. APPROVE a Temp On-Sale Liquor License for Twin Cities Goodtime Softball League on May 28 and 29, 2022 at Northview Park and Lexington-Diffley Athletic Fields G. APPROVE Precinct Boundaries and Polling Locations resolution for 2022 Legislative Redistricting H. APPROVE Request to Accept a Surplus M-ATV I. ACCEPT Donation for Memorial Bench at Thomas Lake Park J. APPROVE Change Order No. 1, Contract 21-28, Gun Club Road Trunk Sanitary Sewer Extension K. AWARD Contract 22-02, 2022 Neighborhood Street Revitalization L. RECEIVE Petition to Vacate Storm Sewer Ponding & Well Field Development Agreements, Lot 1, Block 1, Yankee Doodle Professional Building (1519 Central Parkway), and Schedule a Public Hearing for May 3, 2022 M. RECEIVE Petition to Vacate Drainage & Utility Easements, Lots 1 & 3, Block 1, Fox Forest Addition/ Lot 1, Block 1 Fox Forest 3rd Addition, and Easement Document No. 955421, and Schedule a Public Hearing for May 3, 2022 N. APPROVE Joint Powers Agreement with Dakota County for Project 1462, Diffley Road (CSAH 30 Pavement & Drainage Improvements - County Project No. 30-40) O. APPROVE Joint Powers Agreement with Dakota County for Project 1472, Lone Oak Road (CSAH 26, Vince Trail to Pilot Knob Road) Trail Improvements - County Project No. 26-69) P. APPROVE Joint Powers Agreement with Dakota County for Project 1477, Lone Oak Road (CSAH 26 Corridor Study - County Project No.s 26-66 & 26-67) Q. ITEM PULLED FROM AGENDA R. ITEM PULLED FROM AGENDA S. ITEM PULLED FROM AGENDA T. ADOPT Resolution Delegating Authority to the Director of Finance to Make Reimbursement Declarations for Certain Proposed Projects to be Undertaken by the City U. APPROVE Rate for Special Assessments Over the Next Twelve Months Continued on following V. DIRECT Preparation of an Ordinance Amendment to City Code Chapter 6 Regarding a Rental Licensing Program W. APPROVE a One-year Extension of the Variance Approval for 10-feet to the Required 40-foot Structure Setback from Duckwood Drive, Upon Property Located at 3540 Federal Drive. X. APPROVE the Final Planned Development for Sola Salon located at 4040 Eagan Outlets Parkway Y. APPROVE On-sale and Sunday Liquor License for J & K Inc. Doing Business As Kyuramen at 1278 Town Centre Drive Suite 175 Z. ADOPT a Resolution Authorizing Signing Authority to the Chief of Police to Receive Reimbursement for Tobacco Compliance Checks from the State of Minnesota Department of Human Services Behavior Health Division AA. APPROVE Temporary On-Sale Liquor License and Waive Fee for the Eagan Rotary Community Service Foundation on May 7, 2022 for Event Located at Eagan Festival Grounds Located at Eagan Central Park, 1507 Central Parkway V. PUBLIC HEARINGS A. VACATE Public Drainage and Utility Easement – Lot 12, Block 1, Prettyman Heights (1563 Skyline Trail) VI. OLD BUSINESS A. REZONING and PRELIMINARY PLANNED DEVELOPMENT – Rivers of Life – Mark Abel - A Rezoning from R-1, Residential Single Family to PD, Planned Development for a memory care / enhanced assisted living community and A Preliminary Planned Development to allow a 28-unit memory care/ assisted living facility located at 2811 Pilot Knob Road VII. NEW BUSINESS A. VARIANCE and CONDITIONAL USE PERMIT – Stanley & Wencl - A Variance to deviate from the building material standards for expansion of an existing non-conforming building, and a Conditional Use Permit to allow outdoor storage one cargo container and 17 trucks, 8 of which are to be located at loading docks located at 3285 Terminal Drive VIII. LEGISLATIVE/INTERGOVERNMENTAL AFFAIRS UPDATE IX. ECONOMIC DEVELOPMENT AUTHORITY X. ADMINISTRATIVE AGENDA A. City Attorney B. City Council Comments C. City Administrator D. Director of Public Works E. Director Community Development Continued on following XI. VISITORS TO BE HEARD (For those persons not on the agenda) XII. CLOSED SESSION XIII. ADJOURNMENT Agenda Information Memo April 5, 2022 Eagan City Council Meeting CONSENT AGENDA A.Approve Minutes Action To Be Considered: To approve the following City Council meeting minutes as presented or modified: March 1, 2022 City Council Meeting March 8, 2022 Special City Council Meeting March 15, 2022 City Council Meeting Attachments: (3) CA-1 March 1, 2022 City Council Meeting CA-2 March 8, 2022 Special City Council Meeting CA-3 March 15, 2022 City Council Meeting MINUTES OF A REGULAR MEETING OF THE EAGAN CITY COUNCIL Eagan, Minnesota March 1, 2022 A Listening Session was held at 6:00 p.m. prior to the regular City Council meeting. Present were Mayor Maguire, Councilmembers Bakken, Hansen, Fields, and Supina. A regular Eagan City Council meeting was held on Tuesday, March 1, 2022, at 6:30 p.m. Present were Mayor Maguire, Councilmembers Hansen, Bakken, Fields, and Supina. Also present: City Administrator Osberg, Assistant City Administrator Miller, City Attorney Bauer, Finance Director Feldman, Parks & Recreation Director Pimental, Public Works Director Matthys, City Planner Schultz, and Community Development Director Hutmacher. II. ADOPT AGENDA Councilmember Bakken moved, Councilmember Hansen seconded a motion to approve the agenda as presented. Aye: 5, Nay: 0. Motion carried. III. RECOGNITIONS AND PRESENTATIONS A. Swearing-in of Newly Appointed Eagan Fire Battalion Chiefs and Firefighters Fire Chief Searle introduced the firefighters being sworn in, and City Clerk VanHoose administered the Oath of Office. Fire Chief Searle introduced the Battalion Chiefs being sworn in, and City Clerk VanHoose administered the Oath of Office. B. Recognition of City Administrator Dave Osberg Retirement IV. CONSENT AGENDA Councilmember Supina moved, Councilmember Bakken seconded a motion to approve the Consent agenda as presented. Aye: 5, Nay: 0. Motion carried. A. It was recommended to approve the minutes of the February 8, 2022, Special City Council minutes and the February 15,2022 City Council minutes as presented or modified. B. Personnel items: 1. It was recommended to approve the collective bargaining agreement with the Teamsters Local 320 – Clerical Unit. 2. It was recommended to approve the collective bargaining agreement with the IAFF Local 5171 – Fire Fighter and Fire Captain Unit. 3. It was recommended to accept the resignation/retirement of James Proshek, Police Officer and authorize replacement. 4. It was recommended to approve the hiring for the position of Firefighter, to be named at a future City Council meeting. 5. It was recommended to approve the hiring of the following part-time recurring and seasonal employees: • Peyton Eklund Building Attendant I • Josh Brown Deck Coordinator • Kelly DeVinny Fitness Instructor - Sub • Jacob Tipple Guest Relations Crew • Sean Odean Guest Services ECC • Evalyn Millhollin Lifeguard • Olivia Varpness Lifeguard C. It was recommended to ratify the check registers February 11, 2022, and February 18, 2022, as presented. D. It was recommended to approve the following ordinary and customary contracts: 1. Public Art Contract 22-17-“Passenger Side” 2. Public Art Contract 22-18- "Eagan Bike Rack" 3. Public Art Contract 22-19- Pedersen Metal Design- "Bike Chain" 4. Public Art Contract 22-15- "Ramis Arbor Sculptura, aka Tree Branches" 5. Public Art Contract 22-16- "Grow with Me" 6. Public Art Contract 22-12- "Fowl Play" 7. Public Art Contract 21-26- "Family of Man" 8. Public Art Contract 22-13- "Song of the Flying Dutchman" 9. Public Art Contract 22-14- "Greeting Tower" 10. Public Art Contract 22-21- "Wind Flower" 11. Public Art Contract 22-20- "Come Together" 12. Adler Tank Rentals 13. Sun This Week sponsorship agreement E. It was recommended to approve the naming of Unnamed NE Eagan Park as “Norse Park” F. It was recommended to approve Plans & Specifications Contract 22-01, 2022 Street Improvements and Schedule Bid Opening G. It was recommended to approve Plans & Specifications Contract 22-02, 2022 Street Improvements and Schedule Bid Opening H. It was recommended to cancel Bid Opening Contract 22-11, 2022 Lift Station Rehabilitation (Schwanz Lake) I. It was recommended to receive a Petition to Vacate Public Drainage & Utility Easement, Lot 12, Block 1, Prettyman Heights (1563 Skyline Trail), and Schedule a Public Hearing for April 5, 2022 J. It was recommended to authorize a Letter of Support to Dakota County for Regional Solicitation Letter of Support for Dakota County Projects 26-66 & 26-67 - CSAH 26 (Lone Oak Road) Corridor Study K. It was recommended to approve a Grant Contract Agreement with the Minnesota Department of Public Safety Homeland Security and Emergency Management Division for the Hazard Mitigation Grant for Lightning Detection and Warning at Cascade Bay L. It was recommended to approve a Cooperative Agreement with Northwestern University Center for Public Safety to Conduct the School of Police Staff and Command at the Eagan Police Department V. PUBLIC HEARINGS Certification of Delinquent Nuisance Abatement Bills Finance Director Feldman introduced the item noting the action to be considered is to close the public hearing and approve the final assessment roll for delinquent nuisance abatement bills and authorize certification. At the February 2, 2022, City Council meeting, a public hearing was scheduled for the March 1, 2022, City Council meeting. Director Feldman noted the City currently has 17 properties with nuisance abatement bills that have a delinquent balance. The assessable amount of these accounts totals $7,001.80. Mayor Maguire opened the public hearing. There being no public comment, he turned the discussion back to the Council. Councilmember Fields moved, Councilmember Hansen seconded a motion to close the public hearing and approve the final assessment roll for delinquent nuisance abatement bills and authorize certification to Dakota County for collection with property taxes. Aye: 5, Nay: 0 Motion Carried. Certification of Delinquent Utility Bills City Administrator Osberg introduced the item and handed off to Finance Director Feldman to present the item noting the action to be considered is to close the public hearing and approve the final assessment roll for delinquent utility bills and authorize its certification. At the February 2, 2022, City Council meeting, a public hearing was scheduled for the March 1, 2022, City Council meeting. Director Feldman noted the City currently has approximately 667 utility bill accounts with delinquent balances. The assessable amount of these accounts totals $155,394.01. Mayor Maguire opened the public hearing. There being no public comment, he turned the discussion back to the Council. Councilmember Hansen moved, Councilmember Fields seconded a motion to close the public hearing and approve the final assessment roll for delinquent utility bills and authorize its certification to Dakota County for collection with property taxes. Aye: 5, Nay: 0, Motion Carried. VI. OLD BUSINESS There were no old business items to discuss. VII. NEW BUSINESS COMPREHENSIVE GUIDE PLAN AMENDMENT, REZONING and PRELIMINARY PLANNED DEVELOPMENT – Kwik Trip - Steven Lowe City Administrator Osberg introduced the item noting the request is to authorize staff to submit a Comprehensive Guide Plan Designation to establish the land use designation of IND, Limited Industrial for vacated right-of-way, A Rezoning from I-1, Limited Industrial to PD, Planned Development to allow a 9,200 square foot convenience store and gas station facility, A Preliminary Planned Development to allow a convenience store and gas station located at 3145 & 3125 Dodd Road. City Planner Schultz provided a staff report and location map. Kwik Trip representative Lowe was available for any questions. Councilmember Fields moved, Councilmember Hansen seconded a motion to direct staff to submit to the Metropolitan Council for approval of a Comprehensive Guide Plan Designation and if approved, direct staff to implement the designation of IND, Limited Industrial, for vacated right-of-way upon approximately 0.5 acres, located immediately east of the existing Starks Addition. Aye: 5, Nay: 0, Motion Carried. Councilmember Fields moved, Councilmember Hansen seconded a motion to approve a Rezoning from I-1, Limited Industrial, to PD, Planned Development upon approximately 5 acres located at 3125 and 3145 Dodd Road. Aye: 5 Nay: 0, Motion Carried. Councilmember Hansen moved, Councilmember Fields seconded a motion to approve a Preliminary Planned Development to allow a truck stop with motor fuel sales, car wash, outdoor display and pylon sign, upon approximately 5 acres located at 3125 and 3145 Dodd Road, subject to the conditions listed in the Advisory Planning Commission minutes. Aye: 5 Nay: 0, Motion Carried. The conditions are as follows: 1. A Preliminary Planned Development Agreement shall be executed and recorded against the property at the Dakota County Recorder’s office. The Preliminary PD Agreement shall contain the following plans: a. Preliminary Site Plan b. Preliminary Building Elevations c. Preliminary Landscape Plan d. Preliminary Site Lighting Plan e. Preliminary Signage Plan 2. A Final Planned Development Agreement shall be required prior to issuance of a Building Permit. The following plans are required for the Final Planned Development Agreement and shall be consistent with the approved Preliminary Planned Development: a. Final Site Plan (including outdoor display area) b. Final Building Elevations c. Final Landscape Plan d. Final Site Lighting Plan e. Final Signage Plan f. Final Historical Plan 3. The Planned Development shall have a term of three (3) years. 4. The property shall be replatted into one legal lot of record. 5. The Site Plan shall be revised to meet required setbacks for both the buildings and fuel canopies. 6. The building exterior shall be in conformance with City Code standards which require at least two different Class I and Class II materials comprising at least 65 percent of the building provided not less than 35 percent is Class 1 materials and not more than 35 percent Class III and Class IV materials. 7. Detailed building elevations shall be provided at the time of Final Planned Development for each building. All buildings shall utilize the same architectural finish materials and features, and all building elevations shall be consistent and must be approved at the time of Final Planned Development. 8. The Final Building Elevations provided at the time of Final Planned Development for each building shall include four-sided architecture and meet material finish requirements including visual relief with sections or variations in planes and materials every 40 feet as per City Code standards. 9. The trash enclosure shall be designed consistent with City Code standards in compliance with City Code Section 11.70 Subd. 21.D.7. 10. The enclosure shall have gates providing 90 percent opacity of a durable and low-maintenance material in a color that matches or is complementary to the brick. 11. The applicable performance standards for commercial car washes within City Code section 11.70 Subd. 18 .I. shall be met. 12. Ground-mounted mechanical equipment shall be screened by a fence or wall, or opaque landscaping. 13. The applicant shall revise the sign plan so that no more than three total signs, distributed on up to two elevations, are located upon the convenience store building. 14. The applicant shall revise the sign plan to meet City Code requirements for the fuel and diesel canopies. 15. All signage shall be subject to compliance with the City Sign Code City Code standards, and a Sign Permit shall be obtained prior to installation of any signs. 16. Site lighting shall be provided in conformance with City Code standards. Fixtures shall be downcast and shielded so the source of light is no visible from off the property, illumination throughout the parking lot should be not less than 0.5 footcandles and shall not exceed 1.0 footcandle at the property line. 17. The applicant shall obtain a temporary construction easement or agreement with the neighboring property owners for any off-site grading, in a form acceptable to the City Attorney. 18. All erosion/ sediment control plans submitted for development and grading permits shall be prepared by a designer who has received current Minnesota Department of Transportation (MNDOT) training, or approved equal training as determined by the City Engineer in designing stormwater pollution prevention plans. Also, all personnel responsible for the installation of erosion/ sediment control devices, and the establishment of vegetation for the development, shall have received Erosion/Sediment Control Inspector/Installer certification through the University of Minnesota, or approved equal training as determined by the City Engineer. 19. This development shall comply with Eagan’s Land Disturbance Stormwater Pollution Prevention and Post-Construction Stormwater Management Requirements (City Code Section 4.34) for stormwater management and surface water quality, including land disturbance requirements, and Runoff Rate Control and water quality equivalent of 1.1-inch Volume Control, for effective treatment of the site’s impervious surface area (including effective soil remediation for all of the site’s disturbed soils that are to be revegetated greenspace). 20. The applicant shall provide appropriately sized pre-treatment structures for oil, grit and floatable pollutant separation immediately upstream of any stormwater filtration facility inlet to provide for effective capture and easily-accessible cleanout. Pretreatment structures shall be appropriate for use at fueling facilities and shall be able to provide treatment for the site’s 3.278-acre impervious drainage area, to the satisfaction of the City Engineer. Pre-treatment structures shall be accessible by appropriate maintenance equipment. Details shall be included in applicable plan sheet(s). 21. Prior to receiving City approval to permit land disturbing activity, the applicant shall provide appropriate details for an enhanced-removal filtration basin, which shall include the removal of a majority of dissolved phosphorus from the site’s stormwater runoff to the filtration basin, to the satisfaction of the City Engineer. Details shall include construction cross-sections and notes to include an appropriate impermeable rubber liner, under-drain with cleanout/vents and an adjustable shut-off valve within the outlet structure. Plans shall include iron-sand mix specification/composition/source and appropriate estimated iron-sand mix volume needed based on accepted calculations for majority capture of dissolved phosphorus and minimum of 25-year service life. Basin bottom with exposed iron-sand shall not be planted, but remainder of basin bottom shall be live-planted with appropriate species at 18-inch on-center spacing with biodegradable netting erosion-control blanket. Side slopes shall be seeded or live planted and covered with erosion-control blanket with biodegradable netting. Details shall include temporary erosion-control protections at top and toe of side-slopes and sediment log surrounding the iron-sand filter portion. These graphical details and notes shall be prominently included in all applicable plan sheets (e.g. Grading Plan, Utility Plan, etc.). Pertinent plan sheets shall also include notes that grading and utility contractor(s) shall provide minimum of 24-hours advance notice to City Water Resources Staff of any grading or utility work involving the proposed filtration basin system and installation of any pre-treatment structures, inlets, outlets and any other structural components or critical construction steps, providing contact email and phone number for City Water Resources Staff for arranging inspections at critical construction steps. 22. Prior to receiving city approval to permit land disturbing activity, the property owner shall provide detailed Soil Management Strategies in the plan set for City review, and acceptance by the City Engineer, that provide graphical details and notes on soil protection/restoration in the Stormwater Management Plan and prominently included in all applicable plan sheets (e.g. Erosion & Sediment Control Plan, Grading Plan, Landscape Plan, etc.) and shall specify estimated quantities of soil ripping area and volume of compost to be imported and incorporated on pertinent plan sheet quantity tables. Prior to receiving a Certificate of Occupancy for any affected construction, Soil Management Strategy implementation documentation (e.g. haul tickets, representative on-site soil samples, compaction testing and soil organic content test results) shall be provided to City Water Resources staff to verify approved soil management strategy compliance. Notes shall be provided that implementing contractor shall provide 24- hours advance notice to City Water Resources staff prior to implementation of soil loosening and amendment. 23. Prior to proceeding with land disturbing activity, the Property Owner shall enter into a long- term stormwater management system maintenance agreement with the City, detailing the annual inspection and maintenance required to occur to ensure proper operation and performance of the private permanent stormwater management system, in a form acceptable to the City Attorney. Before the city returns any Stormwater-related Performance Guarantee Fees on the development site, the applicant shall demonstrate that all stormwater management 24. practices are performing as intended and shall provide the City Engineer as-built plans meeting City requirements for as-built standard submittals that demonstrate that all constructed stormwater conveyance structures, stormwater management facilities (oil/water/grit separators, filtration basin, etc.), including greenspace soil loosening & amendment prior to landscaping, conform to design and/or construction plans, as approved by the City. The applicant shall submit to the City Engineer certification that the stormwater management facilities have been installed in accord with the plans and specifications approved. This certification shall be provided by a Professional Engineer licensed in the State of Minnesota. 25. The street, curb and gutter, trail, and boulevard shall be restored in a manner acceptable to the City Engineer. 26. This development shall provide hydrant spacing and locations in accordance with City Fire Department and Public Works standards. 27. Existing drainage and utility easements are currently located in both lots and shall be vacated and rededicated according to current city requirements, in a manner acceptable to the City Engineer. 28. The Landscape Plan shall be revised to provide screening near the transformer pad. 29. The applicant shall fulfill tree mitigation requirements through the installation of ten (10) Category “B” trees or a cash amount of $5,000.00. This required Tree Mitigation shall be in addition to any landscape requirements. 30. The applicant shall submit a revised Landscape plan that clearly identifies ten (10) Category “B” trees for mitigation. 31. The applicant shall ensure the survival of preserved trees via protection of the tree’s critical root zones through the placement of required Tree Protective measures (i.e., orange-colored silt fence or 4-foot polyethylene laminate safety netting), to be installed at the Drip Line or at the perimeter of the Critical Root Zone, whichever is greater. 32. The applicant shall contact the City Forestry Division and set up a pre-construction site inspection at least five days prior to the issuance of the grading permit to ensure compliance with the approved Tree Preservation Plan and placement of the Tree Protection Fencing. 33. For the Final Planned Development, the applicant shall provide a separate Landscape Plan (trees, shrubs, and other plantings), Tree Mitigation Plan (in addition to landscaping), and a combined Overall Planting Plan (showing both mitigation and landscape plant materials). 34. This development is subject to cash park and trail dedication due with the building permit. The 2022 rate for park dedication is $1,057 per 1,000 square feet of building area, and $1,451 per net acre for trail dedication. 35. Approval of the Rezoning and Preliminary Planned Development shall make the existing Conditional Use Permits tied to the property null and void. 36. The applicant shall work with city staff to determine the recognition of historical significance and shall provide a detailed plan for how and where historical information about this site can be included, in order to be visible and available to the public. The historical plan shall be submitted at the time of Final Planned Development for inclusion in the Final Planned Development Agreement. 37. The outdoor display performance standards shall be satisfied except for the display area size which is delineated on the approved Site Plan. COMPREHENSIVE GUIDE PLAN AMENDMENT, REZONING, and PRELIMINARY PLANNED DEVELOPMENT – Rivers of Life – Mark Abel City Administrator Osberg introduced the item noting the request is a Comprehensive Guide Plan Amendment from Low Density (LD) to Office/Service (O/S), a Rezoning from R-1, Residential Single Family to PD, Planned Development, and a Preliminary Planned Development to allow a 28-unit memory care/ assisted living facility located at 2811 Pilot Knob Road. City Planner Schultz presented a staff report and a site map. The architect was present to answer questions from the Council. The Council discussed the site access shown on the current plan, where the only access is via Highview Avenue. The architect stated that this was due to conversations with Dakota County that implied access via Pilot Knob was not permitted. Public Works Director Matthys clarified Dakota County may prefer the access not be on Pilot Knob Road, but because there is no plat requirement, they cannot require it. Councilmember Supina stated preference for an access to Pilot Knob Road that could serve the property, while eliminating the access to the site from Highview Avenue. Councilmember Bakken stated that he could not support the redevelopment if the only access to the property was via Highview Avenue. Mayor Maguire called for comments from the public. Marvin Youness, 1426 Highview Avenue, stated the issue of access to the site is still of concern to the neighborhood. His questions on the need for an environmental impact study and park dedication funds were addressed. Mayor Maguire returned the discussion to the Council for further discussion and motion. Council voiced concerns regarding the lack of access onto Pilot Knob Road. Council suggested the applicant consider waiving the 60-day review to allow plan revisions addressing Councils concerns. City Attorney Bauer stated the plan may need further review by the Advisory Planning Commission, but would depend on the significance of the plan changes. Councilmember Fields moved, Councilmember Bakken seconded a motion to continue this item indefinitely. Aye: 5, Nay: 0, Motion Carried. PLANNED DEVELOPMENT AMENDMENT – Tailwind Technologies – Chris Hypes City Administrator Osberg introduced the item, a Planned Development Amendment to allow a building expansion of approximately 30,000 sq. ft. with 73 additional parking stalls located at 3344 Highway 149. City Planner Schultz provided a staff report and site map. The applicant was present to answer questions. Mayor Maguire inquired about tree mitigation, staff and Shari Ahrens, Westwood Professional Services, clarified future tree mitigation for the project, noting the applicant will work with Staff to determine if additional trees could be installed on the western portion of the site. Councilmember Supina requested clarification of the underground stormwater retention system. Ms. Ahrens clarified the intended capture of additional stormwater. Councilmember Supina also inquired about the site lighting. Ms. Ahrens noted the proposed shields to minimize glare to the adjacent residents. Councilmember Bakken moved, Councilmember Fields seconded a motion to approve a Planned Development Amendment to allow a 30,000 square foot expansion of the building and parking lot expansion at 3344 Hwy. 149, subject to the conditions listed in the APC minutes. Aye: 5, Nay: 0. Motion carried. The conditions are as follows: 1. A Planned Development Amendment Agreement shall be executed and recorded at the Dakota County Recorder’s Office prior to issuance of all required building permits. The following are required for the Agreement: A. Site Plan B. Landscape Plan C. Tree Preservation Plan D. Site Lighting Plan 2. The applicant shall relocate the trash containers within the building or construct an enclosure consistent with City Code standards. 3. Exterior materials for the building addition shall be consistent with existing materials and finishes. Introduction of new materials and colors shall be compatible with the existing building. 4. Any rooftop or ground mounted mechanical equipment shall be shown on the building elevations and site plan submitted for building permit. The plans also shall demonstrate the manner of screening for both ground and rooftop mechanical equipment. 5. The applicant shall provide a revised Site Lighting Plan should for inclusion in the Planned Development Amendment Agreement that shows increased illumination at the outer edges of the parking lot and adjacent to the building, with minimum light levels of 0.5 footcandles throughout and an average to minimum ratio of not less than 4.0 footcandles. House side shields shall be provided. 6. All erosion/ sediment control plans submitted for development and grading permits shall be prepared by a designer who has received current Minnesota Department of Transportation (MNDOT) training, or approved equal training as determined by the City Engineer in designing stormwater pollution prevention plans. Also, all personnel responsible for the installation of erosion/ sediment control devices, and the establishment of vegetation for the development, shall have received Erosion/Sediment Control Inspector/Installer certification through the University of Minnesota, or approved equal training as determined by the City Engineer. 7. This development shall comply with Eagan’s Land Disturbance Stormwater Pollution Prevention and Post-Construction Stormwater Management Requirements (City Code Section 4.34) for stormwater management and surface water quality, including Runoff Rate Control and 1.1-inch Volume Control of effective retention of the site’s new impervious surface area (including effective soil remediation for all of the site’s disturbed soils that are to be revegetated). 8. Prior to receiving City approval to permit land disturbing activity, the applicant shall provide to the City with soil borings equally spaced within the footprint of any proposed infiltration feature, extending a minimum of 10’ below the bottom of the proposed infiltration excavation with continuous sampling, to evaluate and ensure suitability for infiltration of stormwater, including, but not limited to, depth to saturated soils and P200 analysis if SM soils are encountered below the excavation extent. A minimum of 4 soil borings must be provided within the footprint of each of the underground infiltration chamber systems. If the soil boring logs indicate incompatibility of existing sub-soil permeability, or shallow groundwater conflict, or soil contamination, with the submitted and reviewed design plans for meeting volume control requirements, the applicant shall revise the design and/or construction plans to ensure water quality equivalent of volume control requirements are fully met for the mitigated impervious drainage area, to the satisfaction of the City Engineer. 9. The applicant shall provide adequately sized pre-treatment structure (e.g. 4-foot minimum depth sump, 5-foot minimum diameter, with floatable skimmer hood, energy dissipation, etc.) at, or immediately upstream of, any underground stormwater infiltration facility inlet to provide for effective capture and easily-accessible cleanout of fine-sand sized particles and floatable pollutants. Pre-treatment structures shall be accessible by appropriate maintenance equipment. Details shall be included in applicable plan sheet(s) using Eagan Standard Detail Plate E231. 10. Prior to receiving City approval to permit land disturbing activity, the applicant shall provide and include in the plan set all underground stormwater infiltration system details, including that a) an off-line bypass to prevent construction stormwater from entering the infiltration chambers shall be provided until drainage area stabilization, b) solid bottom isolator row (appropriately sized) is provided at any stormwater inlet point into the underground systems, c) no limestone shall be used below or between the infiltration chambers, d) unobstructed physical access via manhole will be provided to either end of the isolator row for inspection and maintenance, e) 10-inch minimum diameter inspection ports will be provided on all infiltration chamber rows. Notes shall be provided that grading and utility contractor(s) shall provide 24-hours advance notice to City Water Resources staff of any grading or utility work involving the proposed infiltration basins and underground infiltration chamber system, including over-excavation, installation of pre-treatment structures, inlets, outlets, sump skimmer hoods, etc. Shop drawings related to the underground stormwater infiltration chamber system must be provided to the City for review before installation. 11. During infiltration system over-excavation/sub-soil work, the applicant shall ensure that a Certified Soil Scientist will be present to verify and document that practice area sub-soils are suitable for a saturated-state infiltration rate of no less than 0.5-inches per hour (based on 0.25-inch per hour design rate with safety factor) or greater (but less than 8.0-inch per hour). If the sub-soil infiltration rates are less than 0.5-inches per hour (or greater than 8.0- inch per hour), the applicant shall immediately notify the City Engineer and revise the volume control practice(s) design and construction as necessary (e.g. over-excavation/soil- amendment depth, etc.) to ensure volume control requirements are fully met. Verification of sub-soil infiltration testing rates shall be provided immediately to the City of Eagan on the day of infiltration testing. The applicant shall ensure that the City Water Resources staff is provided 24-hour advance notice of the occurrence of infiltration verifications and also provided notice prior to any excavation and/or soil backfilling within the infiltration practices, to arrange for inspections. 12. Prior to receiving city approval to permit land disturbing activity, the property owner shall provide detailed Soil Management Strategies in the plan set for City review, and acceptance by the City Engineer, that provide graphical details and notes on soil protection/restoration in the Stormwater Management Plan and prominently included in all applicable plan sheets (e.g. Erosion & Sediment Control Plan, Grading Plan, Landscape Plan, etc.) and shall specify estimated quantities of soil ripping area and volume of compost to be imported and incorporated on pertinent plan sheet quantity tables. Prior to receiving a Certificate of Occupancy for any affected construction, Soil Management Strategy implementation documentation (e.g. haul tickets, representative on-site soil samples, compaction testing and soil organic content test results) shall be provided to City Water Resources staff to verify approved soil management strategy compliance. Notes shall be provided that implementing contractor shall provide 24-hours advance notice to City Water Resources staff prior to implementation of soil loosening and amendment. 13. Prior to proceeding with land disturbing activity, the Property Owner shall enter into a long- term stormwater management system maintenance agreement with the City, detailing the annual inspection and maintenance required to occur to ensure proper operation and performance of the private permanent stormwater management system, in a form acceptable to the City Attorney. 14. Before the city returns any Stormwater-related Performance Guarantee Fees on the development site, the applicant shall demonstrate that all stormwater management practices are performing as intended and shall provide the City Engineer as-built plans meeting City requirements for as-built standard submittals that demonstrate that all constructed stormwater conveyance structures, stormwater management facilities (sump, infiltration basins, underground infiltration chamber gallery, etc.), including soil loosening and amendment prior to landscaping, conform to design and/or construction plans, as approved by the City. Photos/video of final inspection of clean underground infiltration chamber gallery systems and contributing storm sewer shall be provided to the City Engineer. The applicant shall submit to the City Engineer certification that the stormwater management facilities have been installed in accord with the plans and specifications approved. This certification shall be provided by a Professional Engineer licensed in the State of Minnesota. 15. This development shall provide hydrant spacing and locations in accordance with City Fire Department and Public Works standards. 16. The applicant shall provide a contractor parking and staging plan prior in a manner acceptable to the City Engineer, prior to approval of any land disturbing activities. 17. The development shall be responsible for the acquisition of all regulatory agency permits required by the affected agency prior to the issuance of a building permit. 18. The applicant shall fulfill the tree mitigation requirement of two-hundred sixty-two (262) Category B trees or equivalent cash dedication. Financial assurances will be collected with the building permit and in accordance with City Code. 19. The applicant shall submit a revised Landscape Plan that shows the fulfillment of mitigation requirements in the form of trees installed, cash dedication, or a combination of both. 20. A performance guarantee shall be required for the preservation of trees within 15’ of the construction zone. The performance guarantee is to be collected prior to the issuance of any land disturbance permit. 21. The developer shall ensure the survival of preserved trees via protection of the tree’s critical root zones through the placement of required Tree Protective measures (i.e., orange colored silt fence or 4-foot polyethylene laminate safety netting), to be installed at the Drip Line or at the perimeter of the Critical Root Zone, whichever is greater. 22. The developer shall contact the City Forestry Division and set up a pre-construction site inspection at least five days prior to the issuance of the grading permit to ensure compliance with the approved Tree Preservation Plan and placement of the Tree Protection Fencing. VIII. LEGISLATIVE/INTERGOVERNMENTAL AFFAIRS UPDATE There were no Legislative/Intergovernmental affairs items. IX. ECONOMIC DEVELOPMENT AUTHORITY Mayor Maguire called the meeting to order at 9:19 pm. A. CONSENT AGENDA Councilmember Bakken moved, Councilmember Fields seconded a motion to approve the Consent agenda as presented. Aye: 5, Nay: 0. Motion carried. 1. It was recommended to approve the minutes of the January 18, 2022 Economic Development Authority. 2. It was recommended to appoint Dianne Miller as Executive Director effective March 5, 2022. B. EDA ORGANIZATIONAL BUSINESS There were no EDA Organizational Business items. C. OLD BUSINESS There were no Old Business items D. NEW BUSINESS There were no New Business items. E. OTHER BUSINESS There was no other business. F. ADJOURN Councilmember Bakken moved, Councilmember Fields seconded a motion to adjourn the EDA meeting. Aye: 5, Nay: 0. Motion carried. X. ADMINISTRATIVE AGENDA There were no items for the Administrative Agenda. XI. VISITORS TO BE HEARD There were no visitors to be heard. XII. ADJOURNMENT Councilmember Hansen moved, Councilmember Supina seconded a motion to adjourn. Aye: 5, Nay: 0. Motion carried. The meeting was adjourned at 9:20pm. ______ Date ______ Mayor _______ City Clerk MINUTES OF A SPECIAL MEETING OF THE EAGAN CITY COUNCIL Eagan, Minnesota March 8, 2022 A Special Meeting of the Eagan City Council was held on Tuesday, March 8, 2022, at 5:30 p.m. in the Eagan Room. Present were Mayor Maguire, Councilmembers Bakken, Fields, Hansen, and Supina. Also present, City Administrator Miller, Chief of Police Roger New, Community Development Director Hutmacher, Parks & Recreation Director Pimental, Assistant Parks & Recreation Director Flewellen, Luther Wynder, CEO Minnesota Valley Transit Authority (MVTA), Richard Crawford, Public Information Manager MVTA, Gary Swanson, PE, President Energy Management Solutions, Inc. ROLL CALL AND ADOPTION OF THE AGENDA The meeting was called to order at 5:30 p.m. Councilmember Hansen moved, Councilmember Bakken seconded a motion to approve the agenda. Aye: 5; Nay: 0. Motion carried. VISITORS TO BE HEARD There were no visitors to be heard. MINNESOTA VALLEY TRANSIT AUTHORITY (MVTA) UPDATE – Luther Wynder City Administrator Miller introduced Luther Wynder and invited him to present to the Council. Mr. Wynder thanked the Council and provided a presentation providing updates on the pandemic experience, ridership trends, Eagan enhancements, planning for the future, suburban needs, and transit value. ELECTRIC VEHICLE (EV) CHARGING PROPOSAL City Administrator Miller introduced Parks & Recreation Director Pimental and invited him to present the proposal the Council. Director Pimental provided a general overview of the proposal and spoke of other cities participating in similar programs. Gary Swanson of Energy Management Solutions (EMS) described the details of the proposed plan to implement EV Chargers across the city with Carbon Solutions Group as a partner in the project. Staff requested feedback on policy questions, and more generally, whether the proposal fit EV infrastructure needs for the community. At the direction of Council, staff would proceed with preparing a contract for formal approval at a meeting in April. RENTAL LICENSING UPDATE City Administrator Miller introduced Community Development Director Hutmacher to present to the Council regarding rental licensing. Director Hutmacher provided a presentation covering the current rental inventory in Eagan, timeline for rental licensing implementation, and a phased plan for communication and engagement. The Council provided direction on exemptions from the rental licensing program, ordinance provisions, and fees. Communications outreach to the community and stakeholders will begin in April. The City Council is tentatively scheduled to review the rental licensing draft ordinance, budget, staffing plan, and engagement feedback at its June special meeting. POLICE DEPARTMENT UPDATE City Administrator Miller introduced Chief New and invited him to present to the Council. Chief New gave an update on staffing and strategies to alleviate candidate shortages. He also presented an overview of 2021 crime data and some trends Eagan is experiencing. ADJOURNMENT Councilmember Hansen moved, Councilmember Supina seconded a motion to adjourn. Aye: 5, Nay: 0. Motion carried. ______ Date ______ Mayor _______ City Clerk MINUTES OF A REGULAR MEETING OF THE EAGAN CITY COUNCIL Eagan, Minnesota March 15, 2022 A Listening Session was held at 6:00 p.m. prior to the regular City Council meeting. Present were Mayor Maguire, Councilmembers Bakken, Hansen, Fields, and Supina. A regular Eagan City Council meeting was held on Tuesday, March 15, 2022, at 6:30 p.m. Present were Mayor Maguire, Councilmembers Hansen, Bakken, Fields, and Supina. Also present: City Administrator Miller, City Attorney Bauer, Police Chief New, Finance Director Feldman, Parks & Recreation Director Pimental, Public Works Director Matthys, City Planner Schultz, and Community Development Director Hutmacher. II. ADOPT AGENDA Councilmember Bakken moved, Councilmember Fields seconded a motion to approve the agenda as presented. Aye: 5, Nay: 0. Motion carried. III. RECOGNITIONS AND PRESENTATIONS A. Oath of Office for City Administrator Dianne Miller Mayor Maguire introduced City Administrator Miller and welcomed her family and friends in attendance. City Clerk VanHoose administered the Oath of Office. IV. CONSENT AGENDA Councilmember Hansen moved, Councilmember Fields seconded a motion to approve the Consent agenda as presented with the removal of Item H. Aye: 5, Nay: 0. Motion carried. A. ITEM PULLED FROM AGENDA B. Personnel items: 1. It was recommended to authorize the reclassification and title change of ETV Program Production Assistant to Senior Video Production & Digital Content. 2. It was recommended to authorize the hiring of Bryan Hughes, Investigative Specialist & Crime Scene Technician. 3. It was recommended to accept the resignation/retirement of Jennifer Wegner, Police Sargent and authorize replacement. 4. It was recommended to accept the resignation/retirement of Steven Bolluyt, Police Sargent and authorize replacement. 5. It was recommended to approve the promotion of Anthony Sundgaard from Police Officer to Police Sergeant. 6. It was recommended to accept the resignation of Lindsay Benthin, Forestry Maintenance Worker and authorize replacement. 7. It was recommended to approve the hiring of the following part-time recurring and seasonal employees: • Michael Krahn Building Attendant – Skate School • Angela Wohletz Building Attendant I • Josh Brown Deck Coordinator • John Breed Guest Relations Crew • Shayla Dela Torre Mejia Guest Relations Crew • Ian Masterson Guest Relations Crew • Jacob Tipple Guest Relations Crew • Layla Tresedder Guest Relations Crew • Tyler Uhl Guest Relations Crew • Nora Doyle Guest Services - ECC • Kristin Cullen Lifeguard • Elliana Dodge Lifeguard • Keira Halligan Lifeguard • Evalyn Millhollin Lifeguard • Bailey Schmidt Lifeguard • Olivia Varpness Lifeguard • Ryan Madigan Park Laborer • Jacob Brooks Park Laborer • Connor O'Donell Park Laborer • Isaac Kawlewski Park Laborer • Brandon Haley Park Laborer • Zach Wollack Park Laborer • Issac Kawlewski Park Laborer • Kerry Wollin Park Laborer • Patrick Amsden Park Laborer • Taylor Block Pool Attendant • Isaiah Dalzell Pool Attendant • Grace Snell Pool Attendant • Mitchell Young Pool Attendant • Jack Buckenberger Recreation Leader - Camp ECC • Konnie Her Recreation Program Specialist • Hunter Strubhart Stormwater Intern • Andrew Dooley Stormwater Intern • Natalie Emerson Water Resources Intern C. It was recommended to ratify the check registers dated February 25, 2022, and March 4, 2022, as presented. D. It was recommended to approve the following ordinary and customary contracts: 1. Land Use Agreement with Blue Cross Blue Shield 2. Agreement for 2022 Softball Umpire Services with the Baser PL Umpire Association 3. 3 Rental Agreements with MV Ventures for use of Viking Lakes Plaza 4. 18 Agreements for Market Fest 2022 5. Food and Beverage Agreement for State of the City Event with Omni Viking Lakes Hotel 6. Agreement with TK Elevators for repair of elevators at Cedar Grove Parking Garage 7. Agreement with artists: Jessica Huang and Alonzo Pantoja-Patino for teaching workshops with the Eagan Art House. 8. Agreement with Metropolitan Library Service Agency on behalf of Dakota County Library for Eagan Art House services at Lebanon Hills Regional Park and Thompson County Park E. It was recommended to approve an On-Sale and Sunday Liquor License for Sodere Ethiopian Restaurant and Bar located at 1960 Cliff Lake Road F. It was recommended to approve a Temporary On-Sale Liquor License and Waive the License Fee for the Art Works Eagan Event to be Held May 13-15, 2022, at 3795 Pilot Knob Road G. It was recommended to approve a Resolution for Abandoned & Unclaimed Tangible Property and Authorize Sale Thereof H. Pulled from agenda I. It was recommended to award City Contract 22-07, Community Center Boiler/Chiller Replacement J. It was recommended to accept a grant from the Minnesota Department of Human Services to Conduct Tobacco Compliance Checks K. It was recommended to approve a Telecommunications Lease Agreement with Verizon at Southern Lakes Reservoir L. It was recommended to approve a Joint Powers Agreement with Dakota County for the Wetland Health Evaluation Program M. It was recommended to approve a Resolution to MnDOT – State Aid Bond Payment Request N. It was recommended to approve a Resolution Accepting Donation for a Park Bench at Carlson Lake Park O. It was recommended to approve the Final Payment for Contract 20-06 Woodhaven Park Site Improvements P. It was recommended to authorize the submittal of Application for Dakota County Aquatic Invasive Species Grant Q. It was recommended to approve a Wetland Replacement Plan Application, Alliant Ventures Vi, LLC, Parkside Circle R. It was recommended to approve a Joint Powers Agreement between the City of Eagan (as fiscal agent for the Dakota County Drug Task Force) and Dakota County for the administration and distribution of the Violent Crime Teams grant. S. It was recommended to approve a Joint Powers Agreement between the City of Eagan (as fiscal agent for the Dakota County Drug Task Force) and Dakota County for the administration and distribution of the High Intensity Trafficking Areas grant. V. PUBLIC HEARINGS There were no Public Hearings VI. OLD BUSINESS There were no old business items. VII. NEW BUSINESS REZONING, PRELIMINARY PLANNED DEVELOPMENT, and PRELIMINARY SUBDIISION – Parkside Circle – Alliant Ventures V, LLC Administrator Miller introduced the item and invited City Planner Schultz to present a location map and more information. City Planner Schultz provided a site map and presented the staff report regarding property located on Dodd Road near State Highway 3 and 120th Street. Schultz noted the applicant revised the proposed Planned Development standards in an attempt to address the concerns of the Advisory Planning Commission. City Planner Schultz summarized issues raised by residents at the Planning Commission meeting. Schultz noted the Planning Commission recommended approval of Rezoning, but recommended denial of both the Preliminary Planned Development and the Preliminary Subdivision. Schultz added the APC’s stated reasons for denial were due to the requested deviation to lot coverage for all lots regardless of size and lack of clear public benefit of utilizing Planned Development zoning. Council invited the applicant to make any comments. Mr. Bob Machacek explained the changes made to the project following the Advisory Planning Commission meeting and presented the reasons for the requested deviations. Mr. Machacek was available to answer any questions. Council and Staff discussed APC’s recommendations, particularly the support for the rezoning but non- support regarding the Preliminary Planned Development. Mayor Maguire noted for the record the applicant has made revisions following the APC meeting. Council asked staff for clarification of which lots the proposed deviations would apply. Planner Schultz clarified the lots either reduced setbacks or higher lot coverage would apply. Council and staff continued discussion clarifying matters relating to tower setbacks, traffic and drainage from the site. Councilmember Fields inquired about the trail extension to 120th Street. City Planner Schultz noted the trail extension was a request from County Parks. Public Works Director Matthys noted that bollards would be required to prevent vehicles utilizing the trail to access 120th Street. The Mayor called for public comment on the item, adding the Council was provided with written comments that were submitted in advance. Frank Cossetta, 4895 Dodd Rd, shared concerns related to possible wetland impacts from the proposed development. Mr. Cossetta raised concerns for the water quality in Marsh Lake. Andrew McNeal, 4920 Parkside Circle, stated concerns regarding safety of children with increased traffic. Alan Steil, 4930 Dodd Road, stated he is opposed to the development due to safety and that the development will decrease the value of his home and those in his neighborhood. Marcus Ploeger, 710 Marsh Ct, stated he echoed what others have stated and asked Council to consider the public benefit of the development. Miranda Joyce-Schoenecker, 655 Parkside Ct, raised concerns regarding access to the neighborhood for emergency services, which is further restricted when snow is plowed in the cul-de-sac. She also stated lot widths should be consistent with the existing neighborhood. Doug Johnson, 4775 Dodd Road, stated concerns with traffic increases and traffic speeds on Dodd Road. Pat Hamilton, 4764 Dodd Road, stated she would like to see consistency maintained within the development with rules made and enforced across the City. Joe Sperl, 659 Parkside Court, stated that he understood development of the lots was inevitable but asked the Council to ensure development was done as R-1 single family. Public Works Director Matthys responded to questions regarding stormwater management, history of Dodd Road and trail construction, pavement maintenance, and traffic calming on Dodd Road. Mayor Maguire asked if there were any other questions or comments from Council. City Planner Schultz indicated the applicant requested to address the Council. The applicant, Mr. Machacek, requested the item be withdrawn. Mayor Maguire asked the benefit of withdrawing the application and if Council needed to take any formal action. City Attorney Bauer stated that by withdrawing the application, the applicant could submit a new application in a shorter period. Bauer stated that Council recognized the withdrawal of the application, and no action was necessary, staff would follow up with the applicant. The item was formally withdrawn. VIII. LEGISLATIVE/INTERGOVERNMENTAL AFFAIRS UPDATE There were no Legislative/Intergovernmental affairs items. IX. ECONOMIC DEVELOPMENT AUTHORITY There were no Economic Development Authority items. X. ADMINISTRATIVE AGENDA There were no items for the Administrative Agenda. XI. VISITORS TO BE HEARD There were no visitors to be heard. XII. ADJOURNMENT Councilmember Bakken moved, Councilmember Fields seconded a motion to adjourn. Aye: 5, Nay: 0. Motion carried. The meeting was adjourned at 8:20pm. ______ Date ______ Mayor _______ City Clerk Agenda Information Memo April 5, 2022 Eagan City Council Meeting CONSENT AGENDA B. Personnel Items ITEM 1. Action to be Considered: Approve the collective bargaining agreement with Eagan Public Works and Parks Collective Bargaining Unit. Facts: ➢ By order of the Minnesota Public Employer Labor Relations Act, (PELRA) which establishes the rules for collective bargaining between Minnesota public employers and representatives of public employees. ➢ This collective bargaining agreement is effective from January 1, 2022 to December 31, 2022. ➢ The terms and conditions of the Agreement are consistent with City related wages and benefits. ➢ The full Agreement is available in the City Administrator’s office. ITEM 2. Action to be Considered: Approve the revisions to the Employee Handbook. Facts: ➢ Revisions were made to the Flexible Workplace Policy. The policy now identifies not only flexible working locations but also modified working schedules. ➢ The Employee Handbook, in its entirety, may be reviewed online or in the City Administrator’s office. ITEM 3. Action to be Considered: Approve the collective bargaining agreement with the Law Enforcement Labor Services Local #170 – Police Officers Unit. Facts: ➢ By order of the Minnesota Public Employer Labor Relations Act (PELRA) which establishes the rules for collective bargaining between Minnesota public employers and representatives of public employees, Law Enforcement Labor Services Local #170 are the exclusive representatives of the City of Eagan Police Department’s Police Officers. ➢ This collective bargaining agreement is effective from January 1, 2022 to December 31, 2024. ➢ The terms and conditions of the Agreement are consistent with City related wages and benefits. ➢ Article 19.1.A will re-open to establish 2024 wages. ➢ The full Agreement is available in the City Administrator’s office. ITEM 4. Action to be Considered: Approve a Memorandum of Agreement regarding Scheduling between the City of Eagan and the LELS Local #170 – Police Officers. Facts: ➢ Police Administration meets regularly with Police Officers to discuss how Officers are scheduled. ➢ The most recent MOA on scheduling had a sunset date of 12-31-2021. During recent discussions it was proposed to renew the MOA for the 2022 calendar year. ➢ The posting date for the final draft of the 28-day schedule will be done 16 days prior to the beginning of the schedule. The current contract has the posting date for the final draft at 8 days. ➢ The current collective bargaining agreement is set to be in effect from January 1, 2022 to December 31, 2024. Attachments: (1) CB-1 Memorandum of Agreement ITEM 5. Action to be Considered: Approve the hiring of Arlen Madsen for the position of Senior Plumbing and Mechanical Inspector. Facts: ➢ Mr. Madsen has more than four years of inspection experience from surrounding metro area cities. ➢ Council authorized title and classification change in the Community Development Department at the January 18, 2022 meeting. ITEM 6. Accept the resignation/retirement of Bill Hoium, Streets Maintenance Worker, and authorize replacement. Facts: ➢ Mr. Hoium celebrated 33 years with the City of Eagan in March 2022. ➢ Mr. Hoium’s retirement date is May 31, 2022. ITEM 7. Action to be Considered: Accept the resignation/retirement of Joanna Foote, Communications Coordinator, and authorize replacement. Facts: ➢ Ms. Foote celebrated 28 years with the City of Eagan in 2021. ➢ Ms. Foote’s retirement date is June 30, 2022. ➢ Recognition of Ms. Foote will be scheduled for a future City Council meeting. ITEM 8. Action to be Considered: Approve the hiring of the following part-time recurring and seasonal employees: Abdulbari Ahmed Engineering Intern Nicholas Austin Engineering Intern Nathan Willett Forestry Technician Antonio Allen Guest Relations Crew Emma Stok Guest Relations Crew June Moua Guest Relations Crew Levi Zimmerman Guest Relations Crew Samuel Hart Guest Relations Crew Abby Whitcomb Guest Relations Crew Grady Barnridge Guest Relations Crew Mollie Tolic Lifeguard Paige Tolic Lifeguard Andrew Woods Park Laborer Anthony Wills Park Laborer Austin Holm Park Laborer Conor O'Donnell Park Laborer Hannah Stine Park Laborer Jacob Brooks Park Laborer Jeff Kells Park Laborer Lucas Arvidson Park Laborer Nik Bailey Program Assistant - Camp ECC Timothy Leiran Park Laborer Landon Contos Pool Attendant Lauren Ivory Pool Attendant Mary Forester Pool Attendant Kelsey Lamountain Pool Attendant Kendall Peterson Preschool Teacher Alexa Butruff Program Assistant - Camp ECC Mason Hart Recreation Leader - Camp ECC Sreeya Talatam Recreation Leader - Camp ECC Caitlin McWilliams Utility GIS Worker Erik Larson Utility GIS Worker Agenda Information Memo April 5, 2022 Eagan City Council Meeting CONSENT AGENDA C. Ratify Check Registers Action To Be Considered: To ratify the check registers dated March 11, March 18, and March 25 as presented. Attachments: (3) CC-1 Check register dated March 11, 2022 CC-2 Check register dated March 18, 2022 CC-3 Check register dated March 25, 2022 3/10/2022City of Eagan 16:36:19R55CKR2 LOGIS102V 1Page -Council Check Register by GL Check Register w GL Date & Summary 3/11/20223/7/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225201 3/11/2022 139117 ABM ONSITE SERVICES-MIDWEST INC. 3,298.60 CUSTODIAL-MARCH 2022 345172 16921813 3316.65373/10/2022 Janitorial Service Police 3,666.15 CUSTODIAL-MARCH 2022 345172 16921813 3315.65373/10/2022 Janitorial Service City Hall 1,606.20 CUSTODIAL-MARCH 2022 345172 16921813 3313.65373/10/2022 Janitorial Service Fire Buildings 1,693.14 CUSTODIAL-MARCH 2022 345172 16921813 3314.65373/10/2022 Janitorial Service Central Maintenance 1,034.75 CUSTODIAL-MARCH 2022 345172 16921813 6101.65373/10/2022 Janitorial Service Water -Administration 3,298.60 CUSTODIAL-FEB 2022 345173 16909393 3316.65373/10/2022 Janitorial Service Police 3,666.15 CUSTODIAL-FEB 2022 345173 16909393 3315.65373/10/2022 Janitorial Service City Hall 1,606.20 CUSTODIAL-FEB 2022 345173 16909393 3313.65373/10/2022 Janitorial Service Fire Buildings 1,693.14 CUSTODIAL-FEB 2022 345173 16909393 3314.65373/10/2022 Janitorial Service Central Maintenance 1,034.75 CUSTODIAL-FEB 2022 345173 16909393 6101.65373/10/2022 Janitorial Service Water -Administration 22,597.68 225202 3/11/2022 100584 ADVANCED GRAPHIX INC 315.00 ACO GRAPHICS REPAIR FROM DMG 345080 208624 9591.63863/10/2022 Insurance Deductible Risk Management 315.00 225203 3/11/2022 100463 AIM ELECTRONICS INC 327.12 SCOREBOARD FIX 345081 43460 6602.65353/10/2022 Other Contractual Services Equipment Repair & Maint. 327.12 225204 3/11/2022 101396 ALEX AIR APPARATUS, INC. 156.25 AIR TESTING - ST 1 345125 5140 1225.63233/10/2022 Testing Services Fire / EMS Equipment 156.25 AIR TESTING-ST 2 345126 5141 1225.63233/10/2022 Testing Services Fire / EMS Equipment 156.25 AIR TESTING - ST 4 345127 5139 1225.63233/10/2022 Testing Services Fire / EMS Equipment 468.75 225205 3/11/2022 119218 ALLENS SERVICE INC. (R) 100.00 FEB 2022 STORAGE 344863 FEB2022 9699.65383/9/2022 Towing Charges DCDTF state grant 100.00 225206 3/11/2022 142987 APPLE CHEVROLET BUICK NORTHFIELD 13.48 WO 199 344864 81032 9001.14153/9/2022 Inventory - Parts General Fund 11.99 WO 2022-219 344865 81037 9001.14153/9/2022 Inventory - Parts General Fund 25.47 225207 3/11/2022 100360 APPLE FORD LINCOLN APPLE VALLEY 61.03- RETURNED PART 344866 CM559559 9001.14153/9/2022 Inventory - Parts General Fund 81.50 WO 2022-222 344867 555501 9001.14153/9/2022 Inventory - Parts General Fund 374.94 DTF SQUAD-JAN 2022 LEASE 345082 1120-252574-022 522 1105.64573/10/2022 Machinery & Equipment-Rental Investigation/Crime Prevention 3-21-22 3/10/2022City of Eagan 16:36:19R55CKR2LOGIS102V 2Page -Council Check Register by GL Check Register w GL Date & Summary 3/11/20223/7/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225207 3/11/2022 100360 APPLE FORD LINCOLN APPLE VALLEY Continued... 374.94 DTF SQUAD-FEB 2022 LEASE 345083 1120-252574-022 52022 1105.64573/10/2022 Machinery & Equipment-Rental Investigation/Crime Prevention 770.35 225208 3/11/2022 101882 APPLE VALLEY,CITY OF 353.89 SCBA CAL MACHINE TESTING 345123 7624 1225.63233/10/2022 Testing Services Fire / EMS Equipment 353.89 225209 3/11/2022 149635 APPLIED CONCEPTS INC. 606.00 SQUAD SET UP 345084 398500 3511.66803/10/2022 Mobile Equipment Equip Rev Fd-Dept 11 606.00 225210 3/11/2022 141951 ART PARTNERS GROUP 4,110.46 AWARD WALL 345085 15933 1101.64753/10/2022 Miscellaneous General/Admn-Police 830.00 DECSISON WALL 345086 15934 1101.64753/10/2022 Miscellaneous General/Admn-Police 4,940.46 225211 3/11/2022 121083 ASPEN MILLS 3,251.85 UNIFORM T-SHIRTS-FT STAFF 344868 289587 1221.62243/9/2022 Clothing/Personal Equipment Administration-Fire 130.12 UNIFORM PANTS - LATTERY 344869 289655 1221.62243/9/2022 Clothing/Personal Equipment Administration-Fire 393.50 CLASS A UNIFORM-SPRINGER 344870 289598 1221.62243/9/2022 Clothing/Personal Equipment Administration-Fire 627.60 CLASS A UNIFORM-HOFFMAN 344871 289600 1221.62243/9/2022 Clothing/Personal Equipment Administration-Fire 600.20 CLASS A UNIFORM-VOYE 344872 289601 1221.62243/9/2022 Clothing/Personal Equipment Administration-Fire 644.90 CLASS A UNIFORM-TC 344873 289599 1221.62243/9/2022 Clothing/Personal Equipment Administration-Fire 66.24 WINTER HATS 344874 289742 1221.62243/9/2022 Clothing/Personal Equipment Administration-Fire 18.85 ASPEN MILLS 344875 289724 1221.62243/9/2022 Clothing/Personal Equipment Administration-Fire 18.85 ASPEN MILLS 344876 289723 1221.62243/9/2022 Clothing/Personal Equipment Administration-Fire 5,752.11 225212 3/11/2022 101609 ASPEN WASTE 438.23 WASTE REMOVAL 344877 S1322047-030122 6603.65393/9/2022 Waste Removal/Sanitation Servi Building Repair & Maint. 126.77 WASTE 345150 S1366341-030122 3313.65393/10/2022 Waste Removal/Sanitation Servi Fire Buildings 100.00 WASTE 345151 S1322088-030122 2401.65393/10/2022 Waste Removal/Sanitation Servi Gen/Adm-Central Services 125.45 WASTE 345152 S1322005-030122 3313.65393/10/2022 Waste Removal/Sanitation Servi Fire Buildings 537.43 WASTE 345153 S1321957-030122 6827.65393/10/2022 Waste Removal/Sanitation Servi Building Maintenance 172.98 WASTE 345169 S1321981-030122 3313.65393/10/2022 Waste Removal/Sanitation Servi Fire Buildings 353.58 WASTE 345170 S1322021-030122 3304.65393/10/2022 Waste Removal/Sanitation Servi Bldg/Facilities Maintenance 1,169.20 WASTE 345174 S1322104-022822 2401.65393/10/2022 Waste Removal/Sanitation Servi Gen/Adm-Central Services 3,023.64 3/10/2022City of Eagan 16:36:19R55CKR2LOGIS102V 3Page -Council Check Register by GL Check Register w GL Date & Summary 3/11/20223/7/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225213 3/11/2022 100010 ASTLEFORD EQUIP CO INC Continued... 841.50 WO 205 344878 02P14309 9001.14153/9/2022 Inventory - Parts General Fund 478.04 WO 205 344879 02P14301 9001.14153/9/2022 Inventory - Parts General Fund 1,319.54 225214 3/11/2022 159189 AUTOMATION DIRECT INC 90.00 FOR CONTROLS 344880 13257868 6147.62303/9/2022 Repair/Maintenance Supplies-Ge North Plant Production 90.00 225215 3/11/2022 158011 AVESIS 622.16 VISION AVESIS-FEB 2022 345087 2822018 9592.20363/10/2022 Ded payable - Vision Benefit Accrual 13.14 VISION AVESIS-MARCH 2022 345088 2842962 9592.20363/10/2022 Ded payable - Vision Benefit Accrual 630.27 MARCH 2022 345089 2842961 9592.20363/10/2022 Ded payable - Vision Benefit Accrual 1,265.57 225216 3/11/2022 100397 BATTERIES PLUS 288.00 BATTERIES-OFFICE USE 344881 P49214738 1221.62103/9/2022 Office Supplies Administration-Fire 288.00 225217 3/11/2022 100016 BAUER BUILT 207.52 WO 174 344882 180278693 9001.14153/9/2022 Inventory - Parts General Fund 532.92 WO 172 344883 180278692 9001.14153/9/2022 Inventory - Parts General Fund 1,400.00 WO 2022-204 344884 518013792 9001.14153/9/2022 Inventory - Parts General Fund 2,140.44 225218 3/11/2022 160178 BHAKTA, JAYSHAL 5.37 17348 OVRPMNT 813 GREAT OAKS T 344885 030222 9220.22503/9/2022 Escrow Deposits Public Utilities 5.37 225219 3/11/2022 121444 BLUE CROSS AND BLUE SHIELD OF MINNESOTA 70,998.06 MEDICAL INS PREMIUMS - APR 22 344897 220302472298 9592.20173/9/2022 Ded Payable-Insurance BCBS Benefit Accrual 375,269.40 MEDICAL INS PREMIUMS - APR 22 344897 220302472298 9592.61513/9/2022 Health Insurance Benefit Accrual 446,267.46 225220 3/11/2022 160050 BLUE FIRE TRAINING LLC 175.00 BLUE FIRE TRAINING LLC 344886 042322-MILLER 1223.64763/9/2022 Conferences/Meetings/Training Training Fire & EMS 175.00 225221 3/11/2022 159825 BLUESTONE SAFETY PRODUCTS INC 457.30 UNIFORM WEGENER LBV 345090 1651 1104.62243/10/2022 Clothing/Personal Equipment Patrolling/Traffic 457.30 3/10/2022City of Eagan 16:36:19R55CKR2LOGIS102V 4Page -Council Check Register by GL Check Register w GL Date & Summary 3/11/20223/7/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225221 3/11/2022 159825 BLUESTONE SAFETY PRODUCTS INC Continued... 225222 3/11/2022 131767 BOLTON & MENK INC. 9,424.50 SCHWANZ LK LS REHAB 344887 0284997 6439.6712 P14833/9/2022 Project - Engineering Lift Station Maintenanc/Repair 9,424.50 225223 3/11/2022 160179 BOTTS, FAWN 150.00 17348 OVRPMNT 1646 MALLARD DR 345136 030222 9220.22503/10/2022 Escrow Deposits Public Utilities 150.00 225224 3/11/2022 129449 BOYD, WILLIAM 141.98 CLOTHING ALLOWANCE - BOYD 344888 022722 6101.21153/9/2022 Clothing Allowance Water -Administration 141.98 225225 3/11/2022 148751 CAMPBELL KNUTSON 28,847.55 CITY ATTORNEY BILL 345149 3407-999G-02282 2 0602.63113/10/2022 Legal Prosecuting Attorney 28,847.55 225226 3/11/2022 109326 CENTURY COLLEGE 150.00 CPR CERTIFICATIONS 345128 00751453 1223.63203/10/2022 Instructors Training Fire & EMS 150.00 225227 3/11/2022 159431 CENTURY FENCE 704.25 PD GATE REPAIR 345154 219518401 3316.65353/10/2022 Other Contractual Services Police 704.25 225228 3/11/2022 142837 CENTURYLINK (R) 141.08 345137 612E12-8187409- MAR22 6101.63473/10/2022 Telephone Service & Line Charg Water -Administration 141.08 225229 3/11/2022 151299 CINTAS 26.40 RUGS 344889 4112409873 6154.65353/9/2022 Other Contractual Services South Plant Building 20.16 RUGS 345155 4112409846 3313.65693/10/2022 Maintenance Contracts Fire Buildings 5.52 RUGS 345156 4112409902 3313.65693/10/2022 Maintenance Contracts Fire Buildings 25.20 RUGS 345157 4112409800 3313.65693/10/2022 Maintenance Contracts Fire Buildings 23.36 RUGS 345158 4112409806 6827.65693/10/2022 Maintenance Contracts Building Maintenance 37.44 RUGS 345175 4111720890 3316.65693/10/2022 Maintenance Contracts Police 49.20 RUGS 345176 4111720889 3315.65693/10/2022 Maintenance Contracts City Hall 40.48 RUGS 345177 4111720933 3314.65693/10/2022 Maintenance Contracts Central Maintenance 3/10/2022City of Eagan 16:36:19R55CKR2LOGIS102V 5Page -Council Check Register by GL Check Register w GL Date & Summary 3/11/20223/7/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225229 3/11/2022 151299 CINTAS Continued... 227.76 225230 3/11/2022 101753 CITI CARGO & STORAGE 85.00 STORAGE CONTAINER 344890 S1268666 6162.6630 P14243/9/2022 Other Improvements Meter Reading 85.00 225231 3/11/2022 147895 CJ SPRAY 47.20 SPRAYER CABLE ON 341 345138 3206674 3127.62313/10/2022 Mobile Equipment Repair Parts Equipment Maintenance/Repair 47.20 225232 3/11/2022 154192 CLEANCHOICE ENERGY 161.08 1/1/22-1/31/22 344891 INV200341511 9116.64053/9/2022 Electricity Cedar Grove Parking Garage 161.08 225233 3/11/2022 151008 CLOWARD, JASON 164.95 CLOTHING ALLOW JASON CLOWARD 344892 022822 2201.21153/9/2022 Clothing Allowance Gen/Adm-Streets 164.95 225234 3/11/2022 143057 COLUMBIA PIPE AND SUPPLY CO. 721.35 PLUMBING PARTS WELL 8 & 9 344893 3797120 6148.62603/9/2022 Utility System Parts/Supplies North Well Field 335.26 WELL 8 & 9 PLUMBING 344894 3799372 6148.62333/9/2022 Building Repair Supplies North Well Field 1,056.61 225235 3/11/2022 142286 COMCAST 30.10 TV SERVICES-MAR 2022 344895 877210508005717 3-022022 0301.65693/9/2022 Maintenance Contracts IT-Gen & Admn 30.10 225236 3/11/2022 142286 COMCAST 227.35 COMCAST - CABLE MAR 2022 344896 877210508043374 7-021922 6807.63473/9/2022 Telephone Service & Line Charg Fitness Center 227.35 225237 3/11/2022 142286 COMCAST 8.38 3/9/22-4/8/22 344898 877210508073668 5-030122 6146.65353/9/2022 Other Contractual Services North Plant Building 8.38 225238 3/11/2022 142286 COMCAST 10.75 3/1/22-3/31/22 345091 877210508005718 1104.65693/10/2022 Maintenance Contracts Patrolling/Traffic 3/10/2022City of Eagan 16:36:19R55CKR2LOGIS102V 6Page -Council Check Register by GL Check Register w GL Date & Summary 3/11/20223/7/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225238 3/11/2022 142286 COMCAST Continued... 1-022022 10.75 225239 3/11/2022 142286 COMCAST 21.55 COMCAST FEES 3/5-4/4/22 345124 877210508075712 9-022522 1221.65353/10/2022 Other Contractual Services Administration-Fire 21.55 225240 3/11/2022 101973 COMPANION ANIMAL HOSPITAL 3,138.59 KENNELS FOR CITY PETS 345079 258303 1110.63253/9/2022 Vet/Kennel Charge/Animal Dispo Animal Control 3,138.59 225241 3/11/2022 160180 COPPS, ERIC 75.00 17348 OVRPMNT 4687 STAVERN PT 344899 030222 9220.22503/9/2022 Escrow Deposits Public Utilities 75.00 225242 3/11/2022 150880 CORE & MAIN LP 10,219.73 STORZ UPGRADE HYDRANTS 344900 Q360274 6144.66303/9/2022 Other Improvements Hydrant Maintenance/Repair 1,682.72 WATERMAIN REPAIR 344901 Q347735 6160.62603/9/2022 Utility System Parts/Supplies Main Maintenance/Repair 445.06 CURBSTOP REPAIR 344902 Q370040 6130.62603/9/2022 Utility System Parts/Supplies Curb Stop Inspctn/Maint/Repair 3,721.53-RETURN OF BOLTS 344903 Q370665 6160.62603/9/2022 Utility System Parts/Supplies Main Maintenance/Repair 8,929.60 WATERMAIN REPAIR 344904 Q352557 6160.62603/9/2022 Utility System Parts/Supplies Main Maintenance/Repair 2,817.18 METER REPLACEMENT 344905 Q383152 6161.66303/9/2022 Other Improvements Meter Replacement 4,008.54 MAINBREAK REPAIR 344906 Q352405 6160.62603/9/2022 Utility System Parts/Supplies Main Maintenance/Repair 11,875.78 PIPE PLUGS FOR STORM 344907 Q2929401 6438.62603/9/2022 Utility System Parts/Supplies Storm Main Maintenance/Repair 548.72 CURBSTOP REPAIR 344908 Q313123 6130.62603/9/2022 Utility System Parts/Supplies Curb Stop Inspctn/Maint/Repair 36,805.80 225243 3/11/2022 152118 CORNERSTONE COPY BURNSVILLE 2,650.95 ARTSPARK MAILING 344909 190881 3071.63573/9/2022 Advertising/Publication MN State Arts Board 2,650.95 225244 3/11/2022 113795 CULLIGAN 252.70 SOFTNER SALT 344910 848114 6602.62443/9/2022 Chemicals & Chemical Products Equipment Repair & Maint. 252.70 225245 3/11/2022 104675 CUSTOM HOSE TECH, INC. 233.39 HOSE REPAIR 345159 109489 3313.65353/10/2022 Other Contractual Services Fire Buildings 266.83 HOSE REPAIR 345160 109342 3313.65353/10/2022 Other Contractual Services Fire Buildings 500.22 3/10/2022City of Eagan 16:36:19R55CKR2LOGIS102V 7Page -Council Check Register by GL Check Register w GL Date & Summary 3/11/20223/7/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225245 3/11/2022 104675 CUSTOM HOSE TECH, INC.Continued... 225246 3/11/2022 110921 DAKOTA AWARDS & ENGRAVING 66.00 PAR BOARDS 344911 24079 1225.62243/9/2022 Clothing/Personal Equipment Fire / EMS Equipment 66.00 225247 3/11/2022 100050 DAKOTA ELECTRIC 179.76 HOLZ FARM 344912 100914-1-FEB22 3106.64053/9/2022 Electricity Structure Care & Maintenance 24.41 DIFFLEY/LEXINGTON 344913 101738-3-FEB22 3106.64053/9/2022 Electricity Structure Care & Maintenance 30.59 DIFFLEY/LEXINGTON 344914 102634-3-FEB22 3106.64053/9/2022 Electricity Structure Care & Maintenance 100.10 OAK POND RD SAN LIFT STATION 344915 102843-0-FEB22 6239.64083/9/2022 Electricity-Lift Stations Lift Station Maintenanc/Repair 15.96 DIFFLEY/LEXINGTON 344916 103085-7-FEB22 3106.64053/9/2022 Electricity Structure Care & Maintenance 34,167.51 RIVER HILLS STREET LIGHTS 344917 129548-4-FEB22 6301.64063/9/2022 Electricity-Street Lights Street Lighting 51.91 JOHNNYCAKE/CLIFF SIGNALS 344918 141558-7-FEB22 6301.64073/9/2022 Electricity-Signal Lights Street Lighting 66.42 GUN CLUB RD LIFT STATION 344919 166469-7-FEB22 6239.64083/9/2022 Electricity-Lift Stations Lift Station Maintenanc/Repair 261.68 HOLLAND STORM 344920 183413-4-FEB22 6439.64083/9/2022 Electricity-Lift Stations Lift Station Maintenanc/Repair 398.95 ELRENE RD HOCKEY RINK 344921 192536-1-FEB22 3106.64053/9/2022 Electricity Structure Care & Maintenance 774.26 CANTER GLEN STORM 344922 193566-7-FEB22 6439.64083/9/2022 Electricity-Lift Stations Lift Station Maintenanc/Repair 162.05 LEXINGTON RESERVOIR 344923 200603-9-FEB22 6154.64093/9/2022 Electricity-Wells/Booster Stat South Plant Building 15.96 WESCOTT STORM 344924 201101-3-FEB22 6439.64083/9/2022 Electricity-Lift Stations Lift Station Maintenanc/Repair 57.87 WOODLANDS STORM 344925 201125-2-FEB22 6439.64083/9/2022 Electricity-Lift Stations Lift Station Maintenanc/Repair 55.45 NORTHVIEW IRRIGATION 344926 203049-2-FEB22 3106.64053/9/2022 Electricity Structure Care & Maintenance 28.96 OHMAN PARK SHELTER 344927 205375-9-FEB22 3106.64053/9/2022 Electricity Structure Care & Maintenance 15.96 DIFFLEY ROAD TUNNEL LITES 344928 214662-9-FEB22 3106.64053/9/2022 Electricity Structure Care & Maintenance 46.86 DIFFLEY/LEXINGTON 344929 221769-3-FEB22 3106.64053/9/2022 Electricity Structure Care & Maintenance 113.34 CLIFF RD AERATOR 344930 226044-6-FEB22 6520.64053/9/2022 Electricity Basin Mgmt-Aeration 65.92 MAJESTIC OAKS SAN 344931 288226-4-FEB22 6239.64083/9/2022 Electricity-Lift Stations Lift Station Maintenanc/Repair 198.24 HAY LAKE RD AERATOR 344932 371946-5-FEB22 6520.64053/9/2022 Electricity Basin Mgmt-Aeration 15.96 WESCOTT TR GAZEBO 344933 393793-5-FEB22 3106.64053/9/2022 Electricity Structure Care & Maintenance 137.57 STEEPLECHASE CT LIFTSTATION 344934 401500-4-FEB22 6239.64053/9/2022 Electricity Lift Station Maintenanc/Repair 905.34 ART HOUSE 344935 412157-0-FEB22 3106.64053/9/2022 Electricity Structure Care & Maintenance 16.98 ART HOUSE GAZEBO 344936 440126-1-FEB22 3106.64053/9/2022 Electricity Structure Care & Maintenance 68.43 MARSH COVE SAN LIFT STATION 344937 441453-8-FEB22 6239.64083/9/2022 Electricity-Lift Stations Lift Station Maintenanc/Repair 37,976.44 225248 3/11/2022 142095 DAKOTA UNLIMITED 78.00 RAHN PARK FENCE REPAIR 344938 38124 3124.62523/9/2022 Parks & Play Area Supplies Court Maintenance/Set-up 78.00 225249 3/11/2022 100447 DALCO 200.00 CUSTODIAL SUPPLIES 345161 3893322 3304.62233/10/2022 Building/Cleaning Supplies Bldg/Facilities Maintenance 3/10/2022City of Eagan 16:36:19R55CKR2LOGIS102V 8Page -Council Check Register by GL Check Register w GL Date & Summary 3/11/20223/7/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225249 3/11/2022 100447 DALCO Continued... 180.63 CUSTODIAL SUPPLLIES 345171 3900257 6827.62233/10/2022 Building/Cleaning Supplies Building Maintenance 380.63 225250 3/11/2022 148203 DATABANK HOLDINGS LTD 1,159.27 DATABANK RENTAL-APR 2022 344939 138164 0301.64563/9/2022 Building Rental IT-Gen & Admn 1,159.27 225251 3/11/2022 131713 DEERE GOVERNMENT & NATL SALES, JOHN 39,559.92 338 PURCHASE 344940 117268306 3531.66803/9/2022 Mobile Equipment Equip Rev Fd-Dept 31 39,859.93 338 PURCHASE 344941 117268318 3531.66803/9/2022 Mobile Equipment Equip Rev Fd-Dept 31 79,419.85 225252 3/11/2022 118917 DEPARTMENT OF LABOR AND INDUSTRY 3,227.64 FEBRUARY 2022 344942 022822 9001.21953/9/2022 Due to State - Permit Surcharg General Fund 3,227.64 225253 3/11/2022 141848 DH ATHLETICS LLC 994.40 RAHN COURTS CIP 345139 190331 2831.67613/10/2022 Athletic Furnishings Rahn Park 994.40 225254 3/11/2022 101693 DICK'S SANITATION SERVICE INC. 327.43 ORGANICS 345162 DT0004446829 6827.65393/10/2022 Waste Removal/Sanitation Servi Building Maintenance 327.43 225255 3/11/2022 102620 ECOLAB 203.24 CLEANING SUPPLIES 344944 6267461884 6603.62233/9/2022 Building/Cleaning Supplies Building Repair & Maint. 203.24 225256 3/11/2022 142034 ELECTRIC PUMP 26,290.62 LIFTSTATION PUMP IMPELLERS 344945 0072900-IN 6239.62603/9/2022 Utility System Parts/Supplies Lift Station Maintenanc/Repair 26,290.62 225257 3/11/2022 101006 EMERGENCY AUTO TECHNOLOGIES 484.44 PD 344946 JP022522-41 3511.66803/9/2022 Mobile Equipment Equip Rev Fd-Dept 11 909.44 PD 344947 DL02152221B 3511.66803/9/2022 Mobile Equipment Equip Rev Fd-Dept 11 194.48 UNIT 112T 344948 DL030122-20 9001.14153/9/2022 Inventory - Parts General Fund 62,144.00 COMMAND VAN REFURB 344949 SP22001 9346.66803/9/2022 Mobile Equipment Fire Apparatus Revolving 63,732.36 225258 3/11/2022 114540 ESS BROTHERS & SONS, INC. 3/10/2022City of Eagan 16:36:19R55CKR2LOGIS102V 9Page -Council Check Register by GL Check Register w GL Date & Summary 3/11/20223/7/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225258 3/11/2022 114540 ESS BROTHERS & SONS, INC.Continued... 6,972.04 PRV REPAIR PARTS 344950 CC1210 6152.62603/9/2022 Utility System Parts/Supplies PRS Inspection/Maint/Repair 6,972.04 225259 3/11/2022 100062 FACTORY MOTOR PARTS CO 131.25 WO 174 344951 1-7388579 9001.14153/9/2022 Inventory - Parts General Fund 150.12 DEF FLUID EA4 344952 1-7427561 9001.14113/9/2022 Inventory - Motor Fuels General Fund 281.37 225260 3/11/2022 100451 FASTENAL COMPANY 23.00 STREET SIGN INSTALL 344953 MNTC1268239 2242.62573/9/2022 Signs & Striping Material Signs-Installation & Mtn 290.64 PLUMBING SAND PAPER 344954 MNTC1268314 6146.62303/9/2022 Repair/Maintenance Supplies-Ge North Plant Building 313.64 225261 3/11/2022 160200 FELDMAN, MICHAEL 150.00 WATER CONSERVATION REBATE PROG 344955 220226182550 9376.68603/9/2022 Contributions/Cost Sharing Pay Combined Utility Trunk Fund 150.00 225262 3/11/2022 144138 FISCHER MINING LLC 445.09 FILL MATERIAL 344956 166765 6160.62553/9/2022 Street Repair Supplies Main Maintenance/Repair 120.58 FILL MATERIAL 344957 166749 6160.62553/9/2022 Street Repair Supplies Main Maintenance/Repair 383.35 FILL MATERIAL 344958 166737 6160.62553/9/2022 Street Repair Supplies Main Maintenance/Repair 220.90 FILL MATERIAL 344959 166726 6160.62553/9/2022 Street Repair Supplies Main Maintenance/Repair 1,169.92 225263 3/11/2022 143971 FLEETPRIDE 189.97 WO 2022-206 344960 93847394 9001.14153/9/2022 Inventory - Parts General Fund 236.46 WO 2022-206 344961 93893652 9001.14153/9/2022 Inventory - Parts General Fund 426.43 225264 3/11/2022 160199 FOOTE, REBECCA 416.96 CONFERENCE REIMBURSEMENT 344962 022322 6103.64763/9/2022 Conferences/Meetings/Training Training & Education 416.96 225265 3/11/2022 100157 FORCE AMERICA INC 139.20 WO 201 344963 001-1615630 9001.14153/9/2022 Inventory - Parts General Fund 139.20 225266 3/11/2022 153830 FRAME MINNESOTA 490.87 AWARDS BOARD 345093 2994 1101.62103/10/2022 Office Supplies General/Admn-Police 490.87 3/10/2022City of Eagan 16:36:19R55CKR2LOGIS102V 10Page -Council Check Register by GL Check Register w GL Date & Summary 3/11/20223/7/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225266 3/11/2022 153830 FRAME MINNESOTA Continued... 225267 3/11/2022 140634 FRATTALONE AND ASSOCIATES INC. 1,160.20 WIRE FOR SOUND SYSTEM 344964 15089 6603.62333/9/2022 Building Repair Supplies Building Repair & Maint. 1,160.20 225268 3/11/2022 100529 GASTFIELD MAINTENANCE PLUS, BOB 370.00 ART HOUSE CLEANING 344965 022822 3106.65373/9/2022 Janitorial Service Structure Care & Maintenance 370.00 225269 3/11/2022 100465 GERTEN GREENHOUSES 657.96 9001.2245 344966 030122 9001.2245 J05603/9/2022 Escrow - Private Development F General Fund 657.96 225270 3/11/2022 100077 GOPHER ST ONE CALL 33.75 ONE CALL FEE 344967 2020348 0301.65633/9/2022 Landscaping IT-Gen & Admn 203.85 ONE CALL FEE 344967 2020348 6234.63563/9/2022 One Call Service Fee Utility Locates 237.60 225271 3/11/2022 100990 GRAINGER 286.15 TREE SALE BAGS 344968 9225917492 3226.62203/9/2022 Operating Supplies - General Public Education/Education 286.15 225272 3/11/2022 150705 GREAT PLAINS FIRE 1,052.00 RESCUE SAW BLADES 344969 6761 1225.62303/9/2022 Repair/Maintenance Supplies-Ge Fire / EMS Equipment 1,052.00 225273 3/11/2022 160181 GRUBBS, MATT 144.87 17348 OVRPMNT 1616 ASHBURY PL 345140 030222 9220.22503/10/2022 Escrow Deposits Public Utilities 144.87 225274 3/11/2022 100083 HACH CO 197.07 LAB YEAR SUPPLY 344970 12895692 6149.62203/9/2022 Operating Supplies - General Water Sampling/Testing 197.07 225275 3/11/2022 100085 HARDWARE HANK 1,719.00 CHAINSAW 344971 2022569 1225.62343/9/2022 Field/Other Equipment Repair Fire / EMS Equipment 13.95 CHAINSAW BAR OIL 344972 2023041 3222.62203/9/2022 Operating Supplies - General Equipment Mtn 2.98 WO 206 344973 2022600 9001.14153/9/2022 Inventory - Parts General Fund 24.97 STP GARAGE 344974 2021015 6154.62303/9/2022 Repair/Maintenance Supplies-Ge South Plant Building 4.99 LOCK DE-ICER 345163 2023727 3304.62333/10/2022 Building Repair Supplies Bldg/Facilities Maintenance 3/10/2022City of Eagan 16:36:19R55CKR2LOGIS102V 11Page -Council Check Register by GL Check Register w GL Date & Summary 3/11/20223/7/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225275 3/11/2022 100085 HARDWARE HANK Continued... 1,765.89 225276 3/11/2022 156035 HARTFORD, THE 8,155.27 BASIC LIFE, AD&D, LTD-MAR 22 345094 160622061125 9592.61523/10/2022 Life Benefit Accrual 5,793.58 VOL LIFE, AD/D-MAR 2022 345094 160622061125 9592.20213/10/2022 Ded Payable - Insurance Benefit Accrual 6,286.50 BASIC LIFE, AD&D, LTD-FEB 22 345095 160623975668 9592.61523/10/2022 Life Benefit Accrual 4,452.21 VOL LIFE, AD/D-FEB 2022 345095 160623975668 9592.20213/10/2022 Ded Payable - Insurance Benefit Accrual 24,687.56 225277 3/11/2022 100064 HAWKINS WATER TRTMNT GROUP INC 2,554.00 CL2 STP 344975 6128488 6155.62443/9/2022 Chemicals & Chemical Products South Plant Production 2,554.00 225278 3/11/2022 160182 HELLER, MICHELLE 452.77 17348 OVRPMNT 4441B CLOVER LN 345141 030222 9220.22503/10/2022 Escrow Deposits Public Utilities 452.77 225279 3/11/2022 113918 HILLYARD 171.05 EQUIPMENT REPAIR 345164 700494881 3304.62333/10/2022 Building Repair Supplies Bldg/Facilities Maintenance 171.05 225280 3/11/2022 102466 HOIUM, BILL 99.11 CLOTHING ALLOW BILL HOIUM 344976 022622 2201.21153/9/2022 Clothing Allowance Gen/Adm-Streets 99.11 225281 3/11/2022 160183 HOLMEN, DEREK 44.69 17348 OVRPMNT 660 MCFADDENS TR 344977 030222 9220.22503/9/2022 Escrow Deposits Public Utilities 44.69 225282 3/11/2022 100627 HOME DEPOT CREDIT SERVICES 44.93 METAL GARBAGE CANS 345180 4615939 2401.62413/11/2022 Shop Materials Gen/Adm-Central Services 16.48 STOCK BRUSHES 345181 6015808 9001.14153/11/2022 Inventory - Parts General Fund 9.96 VEHICLE CLEANING MAINT 345182 6015811 2244.62203/11/2022 Operating Supplies - General Street Equipment Repair/Mtn 8.97 SALT BROOM 345183 1010054 2244.62203/11/2022 Operating Supplies - General Street Equipment Repair/Mtn 18.18 SHOP VAC FILTER 345184 5524288 2401.62413/11/2022 Shop Materials Gen/Adm-Central Services 22.11 UNIT 1219 LADDER REPAIR R0124 345185 5612522 9001.14153/11/2022 Inventory - Parts General Fund 50.31 SIGN INSTALLATION SUPPLIES 345186 4010670 2242.62573/11/2022 Signs & Striping Material Signs-Installation & Mtn 39.67 SIGN INSTALLATION SUPPLIES 345187 4010711 2242.62573/11/2022 Signs & Striping Material Signs-Installation & Mtn 22.23 BRINE BLDG CLEANING 345188 3612809 2270.62203/11/2022 Operating Supplies - General Building And Grounds-Mtn 16.97 DEGREASE SPRAYER 345189 9011072 2244.62203/11/2022 Operating Supplies - General Street Equipment Repair/Mtn 3/10/2022City of Eagan 16:36:19R55CKR2LOGIS102V 12Page -Council Check Register by GL Check Register w GL Date & Summary 3/11/20223/7/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225282 3/11/2022 100627 HOME DEPOT CREDIT SERVICES Continued... 64.85 SHOP PLUG IN EXTENSIONS 345190 8623233 2401.62413/11/2022 Shop Materials Gen/Adm-Central Services 36.98 SHOP PLUG IN EXTENSIONS 345191 6613853 2401.62413/11/2022 Shop Materials Gen/Adm-Central Services 351.64 225283 3/11/2022 160184 HUDERLE, BRITTANY 16.56 17348 OVRPMNT 4606 LENORE LN 344978 030222 9220.22503/9/2022 Escrow Deposits Public Utilities 16.56 225284 3/11/2022 143243 IMPACT PROVEN SOLUTIONS 1,647.00 UTILITY BILLS PRINT/MAIL - FEB 344979 157486 6201.65353/9/2022 Other Contractual Services San Sewer-Administration 1,647.00 UTILITY BILLS PRINT/MAIL - FEB 344979 157486 6101.65353/9/2022 Other Contractual Services Water -Administration 3,294.00 225285 3/11/2022 104674 INDELCO PLASTICS CORP. 1,148.02 NTP NAMN04 344980 INV310904 6147.62603/9/2022 Utility System Parts/Supplies North Plant Production 61.11 NTP NAMN04 344981 INV312094 6147.62303/9/2022 Repair/Maintenance Supplies-Ge North Plant Production 566.08 NTP NAMN04 344982 INV312455 6147.62603/9/2022 Utility System Parts/Supplies North Plant Production 1,775.21 225286 3/11/2022 145516 INVER GROVE HEIGHTS ANIMAL HOSPITAL 103.84 K9 VET 345096 808798 1104.63253/10/2022 Vet/Kennel Charge/Animal Dispo Patrolling/Traffic 103.84 225287 3/11/2022 119878 KATH FUEL 23,345.66 UNLEAD FUEL 344983 737625 9001.14113/9/2022 Inventory - Motor Fuels General Fund 23,345.66 225288 3/11/2022 100061 KRAEMER MINING & MATERIALS INC. 378.38 FILL MATERIAL 344984 298985 6160.62553/9/2022 Street Repair Supplies Main Maintenance/Repair 378.38 225289 3/11/2022 160185 KRUEGER, RON 19.77 17348 OVRPMNT 4835 SKY VIEW CT 344985 030222 9220.22503/9/2022 Escrow Deposits Public Utilities 19.77 225290 3/11/2022 135589 KULLY SUPPLY INC. 304.74 PLUMBING REPAIR 345178 571790 3304.62333/10/2022 Building Repair Supplies Bldg/Facilities Maintenance 304.74 225291 3/11/2022 158444 LAKEVILLE LICENSE CENTER 3/10/2022City of Eagan 16:36:19R55CKR2LOGIS102V 13Page -Council Check Register by GL Check Register w GL Date & Summary 3/11/20223/7/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225291 3/11/2022 158444 LAKEVILLE LICENSE CENTER Continued... 27.00 03 TOYOTA RAV 4 VIN 238590 344986 030422 9114.64803/9/2022 Licenses, Permits and Taxes Police Forfeiture 27.00 225292 3/11/2022 158444 LAKEVILLE LICENSE CENTER 14.25 SQUAD LICENSES VIN 2296 345097 2296-030322 1104.64803/10/2022 Licenses, Permits and Taxes Patrolling/Traffic 14.25 225293 3/11/2022 158444 LAKEVILLE LICENSE CENTER 14.25 SQUAD LICENSES VIN 2297 345098 2297-030322 1104.64803/10/2022 Licenses, Permits and Taxes Patrolling/Traffic 14.25 225294 3/11/2022 158444 LAKEVILLE LICENSE CENTER 14.25 SQUAD LICENSES VIN 6910 345099 6910-030322 1104.64803/10/2022 Licenses, Permits and Taxes Patrolling/Traffic 14.25 225295 3/11/2022 158444 LAKEVILLE LICENSE CENTER 14.25 SQUAD LICENSES VIN 9222 345100 9222-030322 1104.64803/10/2022 Licenses, Permits and Taxes Patrolling/Traffic 14.25 225296 3/11/2022 158444 LAKEVILLE LICENSE CENTER 29.75 SQUAD LICENSES VIN 1833 345101 1833-030322 1104.64803/10/2022 Licenses, Permits and Taxes Patrolling/Traffic 29.75 225297 3/11/2022 158444 LAKEVILLE LICENSE CENTER 14.25 SQUAD LICENSES VIN 9221 345102 9221-030322 1104.64803/10/2022 Licenses, Permits and Taxes Patrolling/Traffic 14.25 225298 3/11/2022 158444 LAKEVILLE LICENSE CENTER 14.25 SQUAD LICENSES VIN 7119 345103 7119-030322 1104.64803/10/2022 Licenses, Permits and Taxes Patrolling/Traffic 14.25 225299 3/11/2022 100644 LANGUAGE LINE SERVICES 345.22 LANGUAGE LINE-FEB 2022 345104 10474226 1104.63103/10/2022 Professional Services-General Patrolling/Traffic 345.22 225300 3/11/2022 160186 LARSON, REID 31.12 17348 OVRPMNT 4859 SHEFFIELD L 344987 030222 9220.22503/9/2022 Escrow Deposits Public Utilities 31.12 225301 3/11/2022 160187 LE, BRUCE 3/10/2022City of Eagan 16:36:19R55CKR2LOGIS102V 14Page -Council Check Register by GL Check Register w GL Date & Summary 3/11/20223/7/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225301 3/11/2022 160187 LE, BRUCE Continued... 139.16 17348 OVRPMNT 4875 STEEPLECHAS 345142 030222 9220.22503/10/2022 Escrow Deposits Public Utilities 139.16 225302 3/11/2022 160188 LEACH, GRISEL 358.61 17348 OVRPMNT 1855 TACONITE TR 345143 030222 9220.22503/10/2022 Escrow Deposits Public Utilities 358.61 225303 3/11/2022 100420 LEAGUE OF MINN CITIES INS TRUST 124,620.00 INSURANCE PREMIUM 3RD INSTALL 344988 40002962-030422 9591.63853/9/2022 Insurance Risk Management 124,620.00 225304 3/11/2022 160201 LEXINGTON FLATS LP 200.00 FALSE ALARM OVER PMT REFUND 344989 030122 9001.22503/9/2022 Escrow Deposits General Fund 200.00 225305 3/11/2022 139061 LEXISNEXIS RISK DATA MANAGEMENT INC 1,312.50 SOFTWARE MAINTENANCE 344990 805944-20220228 0301.65693/9/2022 Maintenance Contracts IT-Gen & Admn 1,312.50 225306 3/11/2022 100490 LIFEWORKS 181.13 LIFERWORKS CLEANING 345129 339465 3106.65373/10/2022 Janitorial Service Structure Care & Maintenance 181.13 225307 3/11/2022 160189 LORINSER, JENNIFER 15.98 17348 OVRPMNT 4253 LIMESTONE D 344991 030222 9220.22503/9/2022 Escrow Deposits Public Utilities 15.98 225308 3/11/2022 156856 LYNCH CAMPS INC 2,278.84 LYNCH PICKLEBALL LESSONS 344992 020322 6810.63103/9/2022 Professional Services-General Gymnasium 2,278.84 225309 3/11/2022 100116 MACQUEEN EQUIP 1,851.93 RIT BAG ITEMS 344993 P01786 1225.62243/9/2022 Clothing/Personal Equipment Fire / EMS Equipment 18.28-LIGHTS RETURNED.344994 P06542 9001.14153/9/2022 Inventory - Parts General Fund 18.28 PARTS RETURNED.344995 P06541 9001.14153/9/2022 Inventory - Parts General Fund 1,851.93 225310 3/11/2022 158311 MAGPUL INDUSTRIES CORP 1,019.75 SWAT VESTS 345105 ARI1436928 3511.66703/10/2022 Other Equipment Equip Rev Fd-Dept 11 1,019.75 3/10/2022City of Eagan 16:36:19R55CKR2LOGIS102V 15Page -Council Check Register by GL Check Register w GL Date & Summary 3/11/20223/7/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225310 3/11/2022 158311 MAGPUL INDUSTRIES CORP Continued... 225311 3/11/2022 141756 MARCO 82.50 PLOTTER MAINTENANCE 344996 INV9704368 0301.65693/9/2022 Maintenance Contracts IT-Gen & Admn 82.50 225312 3/11/2022 100118 MARKS TOWING 247.50 PENDING WO/ EA1202 344997 592785 9001.14153/9/2022 Inventory - Parts General Fund 247.50 225313 3/11/2022 160190 MARSHALL, TODD 66.98 17348 OVRPMNT 4704 ANNE PT 344998 030222 9220.22503/9/2022 Escrow Deposits Public Utilities 66.98 225314 3/11/2022 140632 MAUER CHEVROLET 259.14 WO 195- COMM. LABOR 344999 6218642/1 9001.14153/9/2022 Inventory - Parts General Fund 259.14 225315 3/11/2022 100125 METRO COUNCIL ENVIRONMTL SERV-SAC 24.85-345000 02282022 0801.42463/9/2022 Administrative Fee on SAC Coll General & Admn-Protective Insp 2,485.00 FEBRUARY 2022 345000 02282022 9220.22753/9/2022 MCES Sewer Availability Charge Public Utilities 2,460.15 225316 3/11/2022 100452 METRO VOLLEYBALL OFFICIALS ASN LLC 450.00 VOLLEYBALL OFFICIALS 345001 1352 3041.63273/9/2022 Sporting Event Officials Adult Volleyball 450.00 225317 3/11/2022 138083 MIDWEST SAFETY COUNSELORS INC. 20.00 CLOTHING ALLOWANCE - GILBERG 345002 IVC0065752 6101.21153/9/2022 Clothing Allowance Water -Administration 34.13 SAFETY EQUIP GILBERG 345002 IVC0065752 6146.62223/9/2022 Medical/Rescue/Safety Supplies North Plant Building 54.13 225318 3/11/2022 102753 MINNCOR INDUSTRIES 60.00 MINNCOR INDUSTRIES - BUSCARDS 345003 SOI-102285 6801.62103/9/2022 Office Supplies General & Administrative 60.00 345004 SOI-102286 0801.62103/9/2022 Office Supplies General & Admn-Protective Insp 60.00 J BROOKER BUSINESS CARDS 345005 SOI-102287 2201.62103/9/2022 Office Supplies Gen/Adm-Streets 180.00 225319 3/11/2022 146961 MINNESOTA EQUIPMENT 781.02 EDGE INVENTORY 345006 P66877 9001.14153/9/2022 Inventory - Parts General Fund 781.02 3/10/2022City of Eagan 16:36:19R55CKR2LOGIS102V 16Page -Council Check Register by GL Check Register w GL Date & Summary 3/11/20223/7/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225319 3/11/2022 146961 MINNESOTA EQUIPMENT Continued... 225320 3/11/2022 100593 MN CHIEFS OF POLICE ASSN 180.00 MN CHIEF DUES COLLINS 345106 12433 1101.64793/10/2022 Dues and Subscriptions General/Admn-Police 1,710.00 MN CHIEFS-TRAINING FEES 345107 13107 1101.64783/10/2022 Tuition and Book Reimbursement General/Admn-Police 510.00 MN CHIEFS-TRAINING FEES 345108 13109 1101.64763/10/2022 Conferences/Meetings/Training General/Admn-Police 510.00 MN CHIEFS-TRAINING FEES 345109 13110 1101.64763/10/2022 Conferences/Meetings/Training General/Admn-Police 2,910.00 225321 3/11/2022 102325 MN DEPT OF TRANSPORTATION 8,106.00 INTERSEC IMPROVE - PU EXPEN 345007 00000692482 8432.67103/9/2022 Project - Contract P1432 TH13/Lone Oak intersecti 90,813.89 INTERSEC IMPROVE - 9375 EXPENS 345007 00000692482 8432.67103/9/2022 Project - Contract P1432 TH13/Lone Oak intersecti 13,292.25 UTILITY RECONSTRUCTIO LOUIS LN 345110 00000693029 8451.67103/10/2022 Project - Contract P1451 TH 55 Mendota Bridge to 112,212.14 225322 3/11/2022 145327 MNSPECT LLC 28,333.90 1/26/22-2/25/22 345008 8910 0801.63103/9/2022 Professional Services-General General & Admn-Protective Insp 28,333.90 225323 3/11/2022 100145 MRPA 125.00 ADVERTISING 345009 10112 1001.63583/9/2022 Employment Advertising General/Admn-Human Resources 125.00 225324 3/11/2022 100146 MTI DISTR CO 506.07-RETURNED 345010 1335363-00 9001.14153/9/2022 Inventory - Parts General Fund 1,365.20 PORTION REFUNDED. PARKS PARTS 345011 1327946-00 9001.14153/9/2022 Inventory - Parts General Fund 859.13 225325 3/11/2022 154636 MURFF, STACEE 124.99 CLOTHING ALLOWANCE - MURFF 345012 020322 6201.21153/9/2022 Clothing Allowance San Sewer-Administration 124.99 225326 3/11/2022 160206 NETA 50.00 NETA JOB POSTING - LOUDI 345013 030822 1001.63583/9/2022 Employment Advertising General/Admn-Human Resources 50.00 225327 3/11/2022 157410 NORTHFIELD SOLAR LLC 5,875.35 ECC ELECTRICITY-JAN 2022 345014 2202-6992C 6824.64053/9/2022 Electricity Utilities 5,875.35 225328 3/11/2022 158656 NORTHLAND REFRIGERATION INC 3/10/2022City of Eagan 16:36:19R55CKR2LOGIS102V 17Page -Council Check Register by GL Check Register w GL Date & Summary 3/11/20223/7/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225328 3/11/2022 158656 NORTHLAND REFRIGERATION INC Continued... 1,179.72 HVAC REPAIR 345165 1403 3314.65353/10/2022 Other Contractual Services Central Maintenance 994.64 HVAC REPAIR 345179 1401 3313.65353/10/2022 Other Contractual Services Fire Buildings 2,174.36 225329 3/11/2022 149916 NORTHWEST LASERS & INSTRUMENTS 78.40 PAINT 345111 17418 8447.67183/10/2022 Project - Other Charges P1447 Deerwood Dr 78.40 PAINT 345111 17418 8446.67183/10/2022 Project - Other Charges P1446 Forest View 78.40 PAINT 345111 17418 8445.67183/10/2022 Project - Other Charges P1445 Cedar Grove Pkwy/Silver 78.40 PAINT 345111 17418 8444.67183/10/2022 Project - Other Charges P1444 Galaxie Ave 78.40 PAINT 345111 17418 8443.67183/10/2022 Project - Other Charges P1443 Johnny Cake Ridge Addn 78.40 PAINT 345111 17418 8442.67183/10/2022 Project - Other Charges P1442 Thomas Center Dr 78.40 PAINT 345111 17418 8441.67183/10/2022 Project - Other Charges P1441 Ches Mar/Oak Chase Way 78.40 PAINT 345111 17418 8440.67183/10/2022 Project - Other Charges P1440 Perron Acres 78.40 PAINT 345111 17418 8439.67183/10/2022 Project - Other Charges P1439 DOdd Rd/Oak Bluffs 78.40 PAINT 345111 17418 8438.67183/10/2022 Project - Other Charges P1438 Town center 784.00 225330 3/11/2022 157481 NRT RELOCATION LLC 16.26 17348 OVRPMNT 1158 LEXINGTON R 345015 030222 9220.22503/9/2022 Escrow Deposits Public Utilities 16.26 225331 3/11/2022 160173 OCEANID WATER RESCUE CRAFT 45.00 MISC REPAIR SUPPLIES 345016 13901 1225.62343/9/2022 Field/Other Equipment Repair Fire / EMS Equipment 45.00 225332 3/11/2022 122435 OFFICE DEPOT (R) 370.15 PAPER REPORT BIND COVER 345017 231659042001 9699.62103/9/2022 Office Supplies DCDTF state grant 147.96 PAPER 345018 231655481001 9699.62103/9/2022 Office Supplies DCDTF state grant 32.65 FORK CREAMER 345018 231655481001 9695.62103/9/2022 Office Supplies Dakota Co Drug Task Force 550.76 225333 3/11/2022 108599 OFFICE DEPOT, INC. 52.79 OFFICE MAX - OFFICE SUPPLIES 345019 230457528001 3001.62103/9/2022 Office Supplies General/Admn-Recreation 91.63 OFFICE SUPPLIES 345020 227976076001 2401.62103/9/2022 Office Supplies Gen/Adm-Central Services 51.48 MARKERS FOR ICE COACHES 345115 230344129001 6611.62203/10/2022 Operating Supplies - General Learn To Skate 10.65 SKATE SCHOOL SUPPLIES 345122 230330203001 6611.62103/10/2022 Office Supplies Learn To Skate 206.55 225334 3/11/2022 160096 OPENDOOR PROPERTY TRUST 53.11 17348 OVRPMNT 4649 ASPEN RIDGE 345021 030222 9220.22503/9/2022 Escrow Deposits Public Utilities 3/10/2022City of Eagan 16:36:19R55CKR2LOGIS102V 18Page -Council Check Register by GL Check Register w GL Date & Summary 3/11/20223/7/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225334 3/11/2022 160096 OPENDOOR PROPERTY TRUST Continued... 53.11 225335 3/11/2022 115253 PELLICCI ACE HARDWARE 8.94 FENCE REPAIR 345144 21593 /E 3103.62203/10/2022 Operating Supplies - General Site Amenity Maintenance 8.94 225336 3/11/2022 114090 PLANT & FLANGED EQUIPMENT COMPANY 6,553.32 NICOLS PRV 345022 0080974-IN 6152.62603/9/2022 Utility System Parts/Supplies PRS Inspection/Maint/Repair 6,553.32 225337 3/11/2022 153556 PURAIR 360.00 O2 BOTTLES MONTHLY CHARGE 345023 0223223274 1225.62223/9/2022 Medical/Rescue/Safety Supplies Fire / EMS Equipment 360.00 225338 3/11/2022 100361 R & R SPECIALTIES INC 60.00 BLADES SHARPENED 345024 0075232-IN 6602.62303/9/2022 Repair/Maintenance Supplies-Ge Equipment Repair & Maint. 60.00 225339 3/11/2022 143557 RANDSTAD (R) 1,270.57 ADMIN ASSIST 2/20-2/26/22 345025 R30713550 9699.65613/9/2022 Temporary Help-Labor/Clerical DCDTF state grant 1,270.57 225340 3/11/2022 152980 REMTECH INC. PEST PROTECTION 173.60 PEST CONTROL 345166 19992 3304.65693/10/2022 Maintenance Contracts Bldg/Facilities Maintenance 119.35 PEST CONTROL 345167 20213 6827.65693/10/2022 Maintenance Contracts Building Maintenance 292.95 225341 3/11/2022 142688 ROILAND, JOANN 17.87 17348 OVRPMNT 4910 BROOKLYN LN 345026 030222 9220.22503/9/2022 Escrow Deposits Public Utilities 17.87 225342 3/11/2022 118036 ROSEMOUNT SAW & TOOL 127.44 CHAINSAW CHAINS 345027 324709 3222.62203/9/2022 Operating Supplies - General Equipment Mtn 127.44 225343 3/11/2022 160191 SCOTT, DEBRORAH 63.49 17348 OVRPMNT 4260 AUGUSTA LN 345028 030222 9220.22503/9/2022 Escrow Deposits Public Utilities 63.49 225344 3/11/2022 160192 SEVERSON, MARK 3/10/2022City of Eagan 16:36:19R55CKR2LOGIS102V 19Page -Council Check Register by GL Check Register w GL Date & Summary 3/11/20223/7/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225344 3/11/2022 160192 SEVERSON, MARK Continued... 97.95 17348 OVRPMNT 848 GREAT OAKS T 345029 030222 9220.22503/9/2022 Escrow Deposits Public Utilities 97.95 225345 3/11/2022 143507 SHATTUCK, HAL 41.42 17348 OVRPMNT 1034 BRIAR CREEK 345030 030222 9220.22503/9/2022 Escrow Deposits Public Utilities 41.42 225346 3/11/2022 159174 SIGN SOLUTIONS 278.70 STREET SIGN INSTALL 345031 400444 2242.62573/9/2022 Signs & Striping Material Signs-Installation & Mtn 278.70 225347 3/11/2022 100193 SIGNATURE CONCEPTS 53.22 UNIFORMS-BRIANTHOM 345032 331286 2401.62243/9/2022 Clothing/Personal Equipment Gen/Adm-Central Services 53.22 225348 3/11/2022 151184 SIMPLIFILE 98.50 DOCUMENTS RECORDING 345033 15004355261 9001.2245 J05133/9/2022 Escrow - Private Development F General Fund 98.50 225349 3/11/2022 160202 SIMPSON, BRIAN 1,242.00 CASCADE BAY OVERCHARGE 345034 081721 9222.2110.13/9/2022 Accounts Payable Cascade Bay 1,242.00 225350 3/11/2022 151416 SMART DELIVERY SERVICE INC 172.00 SMART, INTEROFFICE MAIL 345035 79212 0401.65353/9/2022 Other Contractual Services General & Admn-City Clerk 172.00 225351 3/11/2022 160193 SOLBERG, SCOTT 18.13 17348 OVRPMNT 1572 CLEMSON DR 345036 030222 9220.22503/9/2022 Escrow Deposits Public Utilities 18.13 225352 3/11/2022 153856 ST PAUL PIONEER PRESS 1,020.84 ST PAUL PIONEER PRESS LEGALS 345037 0222570105 0401.63593/9/2022 Legal Notice Publication General & Admn-City Clerk 1,020.84 225353 3/11/2022 100854 ST PAUL STAMP WORKS, INC. 27.52 M JOHNSON DIAS PLATE 345038 IV00525478 0820.62103/9/2022 Office Supplies General/Admn-Housing 27.53 D MILLER DIAS PLATE 345038 IV00525478 0201.62103/9/2022 Office Supplies General & Admn-Admn 55.05 3/10/2022City of Eagan 16:36:19R55CKR2LOGIS102V 20Page -Council Check Register by GL Check Register w GL Date & Summary 3/11/20223/7/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225354 3/11/2022 142767 STANTEC CONSULTING SERVICES INC Continued... 16,361.09 ENGINEERING SERVICES 345039 1893999 6541.6712 P14533/9/2022 Project - Engineering Capital Proj-Renew&Repl-cr1126 16,361.10 ENGINEERING SERVICES 345039 1893999 6541.6712 P14523/9/2022 Project - Engineering Capital Proj-Renew&Repl-cr1126 1,003.00 ENGINEERING SERVICES 345040 1893995 6542.6712 P13263/9/2022 Project - Engineering Capital Proj-WQ dedictn-cr1127 2,667.00 ENGINEERING SERVICES 345041 1893991 6542.6712 P13243/9/2022 Project - Engineering Capital Proj-WQ dedictn-cr1127 1,881.00 ENGINEERING SERVICES 345042 1893998 6541.6712 P14223/9/2022 Project - Engineering Capital Proj-Renew&Repl-cr1126 20,951.69 ENGINEERING SERVICES 345043 1893996 6540.6712 P13213/9/2022 Project - Engineering Capital Proj-Expan&Mod-cr1125 531.00 DATA COLLECTION & MODELING 345112 1894006 6542.6713 P14783/10/2022 Project - Outside Engineering Capital Proj-WQ dedictn-cr1127 1,502.50 DATA COLLECTION & MODELING 345113 1894002 6542.6713 P14363/10/2022 Project - Outside Engineering Capital Proj-WQ dedictn-cr1127 61,258.38 225355 3/11/2022 160194 STELFOX, VICTORIA 72.93 17348 OVRPMNT 2018 CORAL LN 345044 030222 9220.22503/9/2022 Escrow Deposits Public Utilities 72.93 225356 3/11/2022 103083 STERICYCLE, INC. 51.14 SHREDDING SERVICES 345045 8001098987 1101.64573/9/2022 Machinery & Equipment-Rental General/Admn-Police 57.15 SHREDDING SERVICES 345045 8001098987 3001.64573/9/2022 Machinery & Equipment-Rental General/Admn-Recreation 54.15 SHREDDING SERVICES 345045 8001098987 0501.64573/9/2022 Machinery & Equipment-Rental General & Admn-Finance 80.23 SHREDDING SERVICES 345045 8001098987 2401.62103/9/2022 Office Supplies Gen/Adm-Central Services 172.34 SHREDDING SERVICES 345045 8001098987 1101.63103/9/2022 Professional Services-General General/Admn-Police 97.56 SHREDDING SERVICES 345045 8001098987 6801.65693/9/2022 Maintenance Contracts General & Administrative 512.57 225357 3/11/2022 160195 STOTKO, AARON 150.00 17348 OVRPMNT 2001 SAFARI TR 345145 030222 9220.22503/10/2022 Escrow Deposits Public Utilities 150.00 225358 3/11/2022 100204 STREICHERS INC. 610.00 40 MM LAUNCHER 345114 I1554956 1104.66703/10/2022 Other Equipment Patrolling/Traffic 280.00 SWAT VESTS 345116 I1554491 1104.66703/10/2022 Other Equipment Patrolling/Traffic 890.00 225359 3/11/2022 127800 SUPERIOR MECHANICAL COLLISION 2,348.32 TIRE INVENTORY 345046 0160174 9001.14153/9/2022 Inventory - Parts General Fund 2,348.32 225360 3/11/2022 107312 SWEENEY, SEAN 44.87 TRAINING MEALS 345117 021722 1104.64763/10/2022 Conferences/Meetings/Training Patrolling/Traffic 168.48 TRAINING MILEAGE 345117 021722 1104.63533/10/2022 Personal Auto/Parking Patrolling/Traffic 213.35 3/10/2022City of Eagan 16:36:19R55CKR2LOGIS102V 21Page -Council Check Register by GL Check Register w GL Date & Summary 3/11/20223/7/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225360 3/11/2022 107312 SWEENEY, SEAN Continued... 225361 3/11/2022 160207 TELCORDIA TECHNOLOGIES 200.00 INV REFERENCE 345118 10171947 1105.62153/10/2022 Reference Materials Investigation/Crime Prevention 200.00 225362 3/11/2022 103047 TENNANT 286.00 WO 2022-112 345047 918250126 9001.14153/9/2022 Inventory - Parts General Fund 286.00 225363 3/11/2022 134135 THOMSON REUTERS 344.61 CLEAR MONTHLY-FEB 2022 345119 845949511 1105.64573/10/2022 Machinery & Equipment-Rental Investigation/Crime Prevention 344.61 225364 3/11/2022 160196 THOREEN, PETER 93.64 17348 OVRPMNT 3562 SAWGRASS TR 345048 030222 9220.22503/9/2022 Escrow Deposits Public Utilities 93.64 225365 3/11/2022 100107 THYSSENKRUPP ELEVATOR 1,779.79 WATER DAMAGE EMERG CALL 345049 5001751643 9116.65353/9/2022 Other Contractual Services Cedar Grove Parking Garage 543.51 WATER DAMAGE ELEVATOR ADJ 345120 5001765572 9116.65353/10/2022 Other Contractual Services Cedar Grove Parking Garage 2,323.30 225366 3/11/2022 142973 T-MOBILE USA (R) 240.00 22-Z-23 GPS LOCATE 345051 9486433438 9698.6589 H21013/9/2022 Forfeiture Expenditures DCDTF HIDTA 240.00 225367 3/11/2022 148858 TOP NOTCH 216.00 DRAIN CLEANING 345168 2200296 3313.65693/10/2022 Maintenance Contracts Fire Buildings 216.00 225368 3/11/2022 160197 TROCHE, JOSEPH 140.58 17348 OVRPMNT 1873 DEER HILLS 345146 030222 9220.22503/10/2022 Escrow Deposits Public Utilities 140.58 225369 3/11/2022 100232 UHL CO INC 309.86 ACCESS CONTROL REPAIRS 345052 40993 0301.62303/9/2022 Repair/Maintenance Supplies-Ge IT-Gen & Admn 309.86 225370 3/11/2022 115307 ULINE (R) 37.50 GLASS JAR 345053 145638222 9699.62203/9/2022 Operating Supplies - General DCDTF state grant 3/10/2022City of Eagan 16:36:19R55CKR2LOGIS102V 22Page -Council Check Register by GL Check Register w GL Date & Summary 3/11/20223/7/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225370 3/11/2022 115307 ULINE (R)Continued... 105.82 WRAP 345054 145538840 9699.62203/9/2022 Operating Supplies - General DCDTF state grant 143.32 225371 3/11/2022 100236 VAN PAPER 193.60 PAPER PRODUCTS 345055 *3998-00 6603.62333/9/2022 Building Repair Supplies Building Repair & Maint. 193.60 225372 3/11/2022 119217 VERIZON WIRELESS (R) 132.45 FEB 2022 CELL PHONE 345056 9900270397 9699.63553/9/2022 Cellular Telephone Service DCDTF state grant 75.10 FEB 2022 CELL PHONE 345057 9900434574 9699.63553/9/2022 Cellular Telephone Service DCDTF state grant 207.55 225373 3/11/2022 100912 VERIZON WIRELESS, BELLEVUE 41.47 CELL PHONES 345058 9900296000 1001.63553/9/2022 Cellular Telephone Service General/Admn-Human Resources 87.94 CELL PHONES 345058 9900296000 0201.63553/9/2022 Cellular Telephone Service General & Admn-Admn 1,315.35 CELL PHONES 345058 9900296000 0301.63553/9/2022 Cellular Telephone Service IT-Gen & Admn 51.47 CELL PHONES 345058 9900296000 0301.63553/9/2022 Cellular Telephone Service IT-Gen & Admn 190.72 CELL PHONES 345058 9900296000 0501.63553/9/2022 Cellular Telephone Service General & Admn-Finance 207.35 CELL PHONES 345058 9900296000 0720.63553/9/2022 Cellular Telephone Service General Admin-Planning & Zonin 388.07 CELL PHONES 345058 9900296000 0805.63553/9/2022 Cellular Telephone Service Construction Insp-Field 648.58 CELL PHONES 345058 9900296000 0901.63553/9/2022 Cellular Telephone Service Gen & Admin-Communications 15,458.73 CELL PHONES 345058 9900296000 1108.63553/9/2022 Cellular Telephone Service Communications 2,309.95 CELL PHONES 345058 9900296000 2010.63553/9/2022 Cellular Telephone Service General Engineering 557.32 CELL PHONES 345058 9900296000 2201.63553/9/2022 Cellular Telephone Service Gen/Adm-Streets 63.96 CELL PHONES 345058 9900296000 2401.63553/9/2022 Cellular Telephone Service Gen/Adm-Central Services 695.94 CELL PHONES 345058 9900296000 3001.63553/9/2022 Cellular Telephone Service General/Admn-Recreation 754.28 CELL PHONES 345058 9900296000 3170.63553/9/2022 Cellular Telephone Service General AdmIn-Parks 41.47 CELL PHONES 345058 9900296000 3170.63553/9/2022 Cellular Telephone Service General AdmIn-Parks 542.16 CELL PHONES 345058 9900296000 3201.63553/9/2022 Cellular Telephone Service Administrative/General 27.57 CELL PHONES 345058 9900296000 3106.63473/9/2022 Telephone Service & Line Charg Structure Care & Maintenance 74.56 CELL PHONES 345058 9900296000 3301.63553/9/2022 Cellular Telephone Service General Management 1,112.31 CELL PHONES 345058 9900296000 1221.63553/9/2022 Cellular Telephone Service Administration-Fire 40.01 CELL PHONES 345058 9900296000 3075.62203/9/2022 Operating Supplies - General CDBG - Teens 113.83 CELL PHONES 345058 9900296000 3071.62273/9/2022 Recreation Equipment/Supplies MN State Arts Board 1,023.50 CELL PHONES 345058 9900296000 9701.63553/9/2022 Cellular Telephone Service PEG-eligible 1,799.52 CELL PHONES 345058 9900296000 6101.63553/9/2022 Cellular Telephone Service Water -Administration 429.54 CELL PHONES 345058 9900296000 6128.63553/9/2022 Cellular Telephone Service CMMS - Utilities 180.72 CELL PHONES 345058 9900296000 6136.63553/9/2022 Cellular Telephone Service GIS - Utilities 618.40 CELL PHONES 345058 9900296000 6201.63553/9/2022 Cellular Telephone Service San Sewer-Administration 336.93 CELL PHONES 345058 9900296000 6501.63553/9/2022 Cellular Telephone Service G/A - Water Quality 3/10/2022City of Eagan 16:36:19R55CKR2LOGIS102V 23Page -Council Check Register by GL Check Register w GL Date & Summary 3/11/20223/7/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225373 3/11/2022 100912 VERIZON WIRELESS, BELLEVUE Continued... 263.66 CELL PHONES 345058 9900296000 6228.63553/9/2022 Cellular Telephone Service CMMS - Utilities 165.88 CELL PHONES 345058 9900296000 6601.63553/9/2022 Cellular Telephone Service General/Administrative-Arena 41.47 CELL PHONES 345058 9900296000 6716.63553/9/2022 Cellular Telephone Service General Administration 124.41 CELL PHONES 345058 9900296000 6801.63553/9/2022 Cellular Telephone Service General & Administrative 50.02 DETECTIVE ROUTER 345147 9900731950 1105.63553/10/2022 Cellular Telephone Service Investigation/Crime Prevention 29,757.09 225374 3/11/2022 101798 VESSCO INC. 1,538.12 CL2 SENSORS 345059 086878 6147.62603/9/2022 Utility System Parts/Supplies North Plant Production 564.46 CL2 SENSOR SAVED IN RPM 345060 086902 6147.62603/9/2022 Utility System Parts/Supplies North Plant Production 2,102.58 225375 3/11/2022 100237 VIKING ELECTRIC 615.80 ELECT SUPPLIES 345061 S005571062.001 6146.62333/9/2022 Building Repair Supplies North Plant Building 615.80 225376 3/11/2022 100706 WAL MART 47.64 SNOW BRUSHES 345131 384176517 3001.62273/11/2022 Recreation Equipment/Supplies General/Admn-Recreation 4.42 RANGE 345132 386203146 1104.62283/11/2022 Ammunition Patrolling/Traffic 34.90 SUPPLIES 345133 386841078 1105.62123/11/2022 Office Small Equipment Investigation/Crime Prevention 40.97 RECRUITMENT SUPPLIES 345134 386874496 6716.62203/11/2022 Operating Supplies - General General Administration 35.98 SUPPLIES 345135 389447369 3057.62273/11/2022 Recreation Equipment/Supplies Preschool Programs 163.91 225377 3/11/2022 157076 WALCOTT SOLAR LLC 274.49 BAND SHELL - JAN 2022 345062 2202-6993E 3106.64053/9/2022 Electricity Structure Care & Maintenance 126.25 CENTRAL PARK PUMP STATION 345062 2202-6993E 3186.64053/9/2022 Electricity Recreation Program Support 6,386.21 ECC ELECTRICITY-JAN 2022 345062 2202-6993E 6824.64053/9/2022 Electricity Utilities 6,786.95 225378 3/11/2022 156857 WARSAW SOLAR LLC 1,817.66 ECC ELECTRICITY-JAN 345063 2202-6994A 6824.64053/9/2022 Electricity Utilities 1,817.66 225379 3/11/2022 138027 WATER CONSERVATION SERVICE INC. 1,280.15 LEAK DETECTION 345064 12067 6160.63103/9/2022 Professional Services-General Main Maintenance/Repair 1,280.15 225380 3/11/2022 136451 WAUSAU TILE INC. 4,723.02 GARBAGE CANS 345130 644162 3103.66303/10/2022 Other Improvements Site Amenity Maintenance 3/10/2022City of Eagan 16:36:19R55CKR2LOGIS102V 24Page -Council Check Register by GL Check Register w GL Date & Summary 3/11/20223/7/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225380 3/11/2022 136451 WAUSAU TILE INC.Continued... 4,723.02 225381 3/11/2022 160198 WELCH, LYNN 49.71 17348 OVRPMNT 4016 CEDAR GROVE 345065 030222 9220.22503/9/2022 Escrow Deposits Public Utilities 49.71 225382 3/11/2022 139583 WENZEL PLUMBING 5,415.00 PLUMBING REPAIR WATER MECH ROO 345121 34480 9116.65353/10/2022 Other Contractual Services Cedar Grove Parking Garage 5,415.00 225383 3/11/2022 104564 WILSON BOHANNAN COMPANY 470.75 PAD LOCKS FIELD AND PRODUCTION 345066 0189196-IN 6146.62603/9/2022 Utility System Parts/Supplies North Plant Building 470.75 225384 3/11/2022 101755 XCEL ENERGY 331.06 CENTRAL PKWY STREET LIGHTS 345067 51-6563390-9-02 2422 6301.64063/9/2022 Electricity-Street Lights Street Lighting 331.06 225385 3/11/2022 101755 XCEL ENERGY 3,312.16 STREET LIGHTS 345068 51-6563390-9-03 0322 6301.64063/9/2022 Electricity-Street Lights Street Lighting 3,312.16 225386 3/11/2022 101755 XCEL ENERGY 241.47 CEDAR GROVE PKWY STREET LITES 345069 51-0010060024-7 -022322 6301.64063/9/2022 Electricity-Street Lights Street Lighting 241.47 225387 3/11/2022 101755 XCEL ENERGY 12.21 MONUMENTS LIGHTING 345070 51-0010165807-6 -022322 6301.64063/9/2022 Electricity-Street Lights Street Lighting 12.21 225388 3/11/2022 101755 XCEL ENERGY 199.82 CEDAR GROVE BLVD STREET LITES 345071 51-0280165-0-02 2322 6301.64063/9/2022 Electricity-Street Lights Street Lighting 199.82 225389 3/11/2022 101755 XCEL ENERGY 3/10/2022City of Eagan 16:36:19R55CKR2LOGIS102V 25Page -Council Check Register by GL Check Register w GL Date & Summary 3/11/20223/7/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225389 3/11/2022 101755 XCEL ENERGY Continued... 74.31 CENTRAL PKWY/QUARRY RD 345072 51-0012991086-6 -022422 6301.64063/9/2022 Electricity-Street Lights Street Lighting 74.31 225390 3/11/2022 101755 XCEL ENERGY 642.24 BURR OAKS LIFT STATION 345073 51-0011013079-4 -022422 6439.64083/9/2022 Electricity-Lift Stations Lift Station Maintenanc/Repair 642.24 225391 3/11/2022 101755 XCEL ENERGY 1,383.93 WELL #6 345074 51-0013502997-4 -022422 6148.64093/9/2022 Electricity-Wells/Booster Stat North Well Field 1,383.93 225392 3/11/2022 101755 XCEL ENERGY 347.01 ELECTRIC CABINET-NICOLS RD 345075 51-0010197923-4 -022322 6301.64063/9/2022 Electricity-Street Lights Street Lighting 347.01 225393 3/11/2022 158816 ZILLOW HOMES INC 78.55 17348 OVRPMNT 3655 DENMARK AVE 345076 030222-1 9220.22503/9/2022 Escrow Deposits Public Utilities 78.55 225394 3/11/2022 158816 ZILLOW HOMES INC 60.84 17348 OVRPMNT 3407 CHESTNUT LN 345077 030222-2 9220.22503/9/2022 Escrow Deposits Public Utilities 60.84 225395 3/11/2022 158816 ZILLOW HOMES INC 50.00 17348 OVRPMNT 513 TYNE LANE 345078 030222-3 9220.22503/9/2022 Escrow Deposits Public Utilities 50.00 225396 3/11/2022 158816 ZILLOW HOMES INC 100.00 17348 OVRPMNT 3413 CHESTNUT LN 345148 030222 9220.22503/10/2022 Escrow Deposits Public Utilities 100.00 1000219 3/11/2022 120622 DAKOTA COMMUNICATIONS CENTER 117,588.00 DCC FEES MONTHLY-APR 22 345092 EA2022-04 1108.63303/10/2022 DCC Fees Communications 117,588.00 1000220 3/11/2022 101697 EAGAN CONVENTION & VISITORS BUREAU 3/10/2022City of Eagan 16:36:19R55CKR2LOGIS102V 26Page -Council Check Register by GL Check Register w GL Date & Summary 3/11/20223/7/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 1000220 3/11/2022 101697 EAGAN CONVENTION & VISITORS BUREAU Continued... 66,491.38 ECVB LODGING TAX JAN 2022 344943 0122 9001.22103/9/2022 Due to Convention Bureau General Fund 1,630.04-ECVB OFFICE RENT JAN 2022 344943 0122 6801.46213/9/2022 Building Rent General & Administrative 20.00-ECVB PHONE MAINT 344943 0122 6801.63473/9/2022 Telephone Service & Line Charg General & Administrative 1,230.35-ECVB LEASE PAYMENT 344943 0122 9337.1386.13/9/2022 Due from ECVB Community Investment 236.32-ECVB LEASE PAYMENT INTEREST 344943 0122 9337.4613.43/9/2022 Int on IR-ECVB Community Investment 63,374.67 1000221 3/11/2022 146452 TIMM, MELISSA 5.27 MELISSA'S MILEAGE 345050 022822 0401.63533/9/2022 Personal Auto/Parking General & Admn-City Clerk 5.27 20225204 3/11/2022 100283 BERKLEY ADMINISTRATORS 35,000.00 WC ACCOUNT TRANSFER 345192 030822 9593.16503/11/2022 Worker's Comp Advance to DCA Workers' Compensation Self-In 35,000.00 20225610 3/11/2022 147907 SELECT ACCOUNT 6,403.76 FLEX REIMBURSEMENT 345193 030822 9592.22153/11/2022 Flex Plan Withholding Payable Benefit Accrual 6,403.76 20225804 3/11/2022 147907 SELECT ACCOUNT 500.00 VEBA-KOLLER/KLINKHAMMER/CARLET 345194 030722 9592.61593/11/2022 VEBA Benefit Accrual 500.00 20228510 3/11/2022 151185 HEALTHPARTNERS INC 5,283.56 DENTAL CLAIMS REIMBURSEMENT 345195 030722 9594.61583/11/2022 Dental Insurance Dental Self-insurance 5,283.56 1,525,545.87 Grand Total Payment Instrument Totals Checks 1,344,577.93 180,967.94A/P ACH Payment Total Payments 1,525,545.87 3/10/2022City of Eagan 16:36:23R55CKS2LOGIS100 1Page -Council Check SummaryNote: Payment amount may not reflect the actual amount due to data sequencing and/or data selection. 3/11/20223/7/2022 - Company Amount 374,488.8409001GENERAL FUND 27.0009114POLICE FORFEITURE 7,899.3809116CEDAR GROVE PARKING GARAGE 1,023.5009197ETV 217,401.6109220PUBLIC UTILITIES 2,863.1009221CIVIC ARENA 1,324.4409222CASCADE BAY 16,405.5409223CENTRAL PARK /COMMUNITY CENTER 994.4009328PARK SYS DEV AND R&R 82,439.4809335EQUIPMENT REVOLVING 1,466.67-09337 COMMUNITY INVESTMENT 62,144.0009346FIRE APPARATUS REVOLVING 112,996.1409372REVOLVING SAF-CONSTRUCTION 150.0009376COMBINED UTILITY TRUNK FUND 124,935.0009591RISK MANAGEMENT 479,124.3509592BENEFIT ACCRUAL 35,000.0009593WORKERS' COMPENSATION SELF-INS 5,283.5609594Dental Self-insurance 2,512.2009695DAK CO DRUG TASK FORCE Report Totals 1,525,545.87 3/18/2022City of Eagan 10:41:43R55CKR2 LOGIS102V 1Page -Council Check Register by GL Check Register w GL Date & Summary 3/18/20223/14/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225397 3/18/2022 100742 ABC RENTALS INC. 304.13 WO 267 345196 284228 9001.14153/16/2022 Inventory - Parts General Fund 304.13 225398 3/18/2022 100360 APPLE FORD LINCOLN APPLE VALLEY 61.03 2022-133 345197 559559 9001.14153/16/2022 Inventory - Parts General Fund 102.60 STOCK PARTS 345198 560766 9001.14153/16/2022 Inventory - Parts General Fund 163.63 225399 3/18/2022 144673 ARCADE ELECTRIC 218.00 ELECTRICAL REPAIR 345199 13142 3313.65353/16/2022 Other Contractual Services Fire Buildings 215.00 ELECTRICAL REPAIR 345200 13141 3313.65353/16/2022 Other Contractual Services Fire Buildings 215.00 ELECTRICAL WORK 345201 13139 3313.65353/16/2022 Other Contractual Services Fire Buildings 523.00 ELECTRICAL WORK 345202 13148 3316.65353/16/2022 Other Contractual Services Police 1,171.00 225400 3/18/2022 121083 ASPEN MILLS 18.85 ASPEN MILLS 345203 290027 1221.62243/16/2022 Clothing/Personal Equipment Administration-Fire 18.85 225401 3/18/2022 140466 ASPENWALL TREE SERVICE INC. 1,800.00 EAB - TREE REMOVAL PROGRAM 345204 22-1032 9111.65713/16/2022 Tree mitigation Tree mitigation 2,350.00 EAB - TREE REMOVAL PROGRAM 345205 22-1033 9111.65713/16/2022 Tree mitigation Tree mitigation 4,500.00 EAB - TREE REMOVAL PROGRAM 345206 22-1031 9111.65713/16/2022 Tree mitigation Tree mitigation 2,800.00 TRAPP - HAZARD BOUNDARY TREES 345207 22-1035 3203.65453/16/2022 Tree Removal Park Tree Management 1,800.00 EAB - TREE REMOVAL PROGRAM 345208 22-1036 9111.65713/16/2022 Tree mitigation Tree mitigation 1,750.00 PEP - STORM DAMAGED PARK TREE 345209 22-1034 3221.65453/16/2022 Tree Removal Emergency management 15,000.00 225402 3/18/2022 159189 AUTOMATION DIRECT INC 16.50 CONTROL BOX PARTS 345391 13311227 6147.62303/17/2022 Repair/Maintenance Supplies-Ge North Plant Production 16.50 225403 3/18/2022 146391 BLOOMINGTON, CITY OF 792.00 LABORATORY SERVICES 345210 20496 6149.63233/16/2022 Testing Services Water Sampling/Testing 792.00 225404 3/18/2022 129449 BOYD, WILLIAM 199.99 CLOTHING ALLOWANCE - BOYD 345213 030322 6101.21153/16/2022 Clothing Allowance Water -Administration 199.99 3-21-22 3/18/2022City of Eagan 10:41:43R55CKR2LOGIS102V 2Page -Council Check Register by GL Check Register w GL Date & Summary 3/18/20223/14/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225405 3/18/2022 122367 BURNSVILLE POLICE DEPT (R)Continued... 262.61 OCDETF AUG 21 RAIN MAKER 345341 030822 9693.65803/17/2022 Reimb to Cities & Counties DCDTF OCDETF 225.09 12-DC-1222 DEC 2021 345341 030822 9695.6580 AHT213/17/2022 Reimb to Cities & Counties Dakota Co Drug Task Force 487.70 225406 3/18/2022 142846 CENTURYLINK 141.08 345211 612E12-8187409- MAR22 6101.63473/16/2022 Telephone Service & Line Charg Water -Administration 141.08 225407 3/18/2022 151299 CINTAS 20.64 RUGS 345378 4093443654-0819 21 3313.65693/17/2022 Maintenance Contracts Fire Buildings 10.08 RUGS 345379 4093443673-0819 21 6827.65693/17/2022 Maintenance Contracts Building Maintenance 10.80 RUGS 345380 4093443627-0819 21 3313.65693/17/2022 Maintenance Contracts Fire Buildings 5.52 RUGS 345381 4093443616-0819 21 3313.65693/17/2022 Maintenance Contracts Fire Buildings 47.04 225408 3/18/2022 147895 CJ SPRAY 47.40 CABLE REPAIR SPRAY GUN 345212 3206952 3127.62313/16/2022 Mobile Equipment Repair Parts Equipment Maintenance/Repair 47.40 225409 3/18/2022 146512 COMPASS MINERALS AMERICA 42,044.34 ROAD SALT 345392 969351 2240.62563/17/2022 Snow Removal/Ice Control Suppl Street Plowing/Sanding 15,143.50 ROAD SALT 345393 970300 2240.62563/17/2022 Snow Removal/Ice Control Suppl Street Plowing/Sanding 57,187.84 225410 3/18/2022 102464 COPY-RIGHT PRINTING & GRAPHICS 1,796.11 PRINTING-POSTCARD P&RSUMM22 345385 89315 0904.63703/17/2022 General Printing and Binding Discover Parks Brochure 889.50 MAIL PREP-POSTCARD P&RSUMM22 345385 89315 0904.63463/17/2022 Postage Discover Parks Brochure 2,685.61 225411 3/18/2022 152118 CORNERSTONE COPY BURNSVILLE 228.69 SPARK! RACK CARDS 345214 190912 3060.63573/16/2022 Advertising/Publication Spark! Mobile 130.47 PROMOTION 345215 190925 3081.63573/16/2022 Advertising/Publication Arts & Humanities Council 524.72 PROMOTION 345216 190969 3071.63573/16/2022 Advertising/Publication MN State Arts Board 883.88 3/18/2022City of Eagan 10:41:43R55CKR2LOGIS102V 3Page -Council Check Register by GL Check Register w GL Date & Summary 3/18/20223/14/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225412 3/18/2022 144440 COVERTTRACK GROUP INC.Continued... 1,800.00 SOFTWARE MAINTENANCE 345342 29077 0301.65693/17/2022 Maintenance Contracts IT-Gen & Admn 1,800.00 225413 3/18/2022 102141 DAK CTY SHERIFF'S OFFICE 440.88 OCDETF AUG 21 RAIN MAKER 345343 030822 9693.65803/17/2022 Reimb to Cities & Counties DCDTF OCDETF 269.40 OCDETF OCT 21 FAMILY TYES 345343 030822 9693.65803/17/2022 Reimb to Cities & Counties DCDTF OCDETF 813.72 12-DC-1222 DEC 2021 345343 030822 9695.6580 AHT213/17/2022 Reimb to Cities & Counties Dakota Co Drug Task Force 1,524.00 225414 3/18/2022 100048 DAK CTY TECHNICAL COLLEGE 900.00 DAK CTY TECHNICAL COLLEGE 345217 00186267 1223.64763/16/2022 Conferences/Meetings/Training Training Fire & EMS 900.00 225415 3/18/2022 144803 DAKOTA COUNTY - PERMITS OFFICE 125.00 PERMIT NO 41655 345218 41655 2010.64803/16/2022 Licenses, Permits and Taxes General Engineering 125.00 225416 3/18/2022 102214 DAMA METAL PRODUCTS, INC. 119.00 MULTI HOUSING KEY BOXES 345219 15949 1104.62263/16/2022 Public Safety Supplies Patrolling/Traffic 119.00 225417 3/18/2022 100053 DELEGARD TOOL CO 55.30 323 VAN TOOLS 345220 133517/1 3129.62403/16/2022 Small Tools Shop Mtn/General Repairs 55.30 225418 3/18/2022 100528 DELL MARKETING L P 1,076.22 345221 10565422178 2010.66603/16/2022 Office Furnishings & Equipment General Engineering 1,836.72 COMPUTER REPLACEMENT 345222 10565509520 6101.66703/16/2022 Other Equipment Water -Administration 2,912.94 225419 3/18/2022 101693 DICK'S SANITATION SERVICE INC. 85.42 WASTE REMOVAL 345344 DT0004476378 6603.65393/17/2022 Waste Removal/Sanitation Servi Building Repair & Maint. 85.42 225420 3/18/2022 100396 DORNSEIF, MARK 285.27 CLOTHING ALLOWANCE-DORNSEIF 345223 030522 3170.21153/16/2022 Clothing Allowance General AdmIn-Parks 285.27 225421 3/18/2022 126333 DUNN & SEMINGTON PRINTING DESIGN 56.95 SKATE SCHOOL SUPPLIES 345345 53195 6611.62203/17/2022 Operating Supplies - General Learn To Skate 3/18/2022City of Eagan 10:41:43R55CKR2LOGIS102V 4Page -Council Check Register by GL Check Register w GL Date & Summary 3/18/20223/14/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225421 3/18/2022 126333 DUNN & SEMINGTON PRINTING DESIGN Continued... 56.95 225422 3/18/2022 147796 EAGAN POLICE DEPARTMENT 61.94 OCDETF AUG 21 RAIN MAKER 345346 030822 9693.65803/17/2022 Reimb to Cities & Counties DCDTF OCDETF 315.00 12-DC-1222 DEC 2021 345346 030822 9695.6580 AHT213/17/2022 Reimb to Cities & Counties Dakota Co Drug Task Force 376.94 225423 3/18/2022 115589 EAGAN SENIOR BOARD 4,692.00 SENIOR BOARD REIMBURSEMENT 345224 22-00103-030322 3078.62273/16/2022 Recreation Equipment/Supplies Senior Citizens 4,692.00 225424 3/18/2022 100060 ECM PUBLISHERS INC 225.00 INDOOR MARKET AD 345225 880551 3061.63573/16/2022 Advertising/Publication Market Fest 225.00 225425 3/18/2022 158692 ELLIE FAMILY SERVICES 125.00 NECK UP CHECK UP OFCS 345226 1050 1101.63193/16/2022 Medical Services - Other General/Admn-Police 125.00 225426 3/18/2022 147251 EMPIRE PIPE SERVICES 3,413.02 CHIPMUNKCT SANITARY BACKUP 345394 3509 6238.64323/17/2022 Utility System Repair-Labor Sewer Main Maintenance 3,413.02 225427 3/18/2022 100451 FASTENAL COMPANY 217.50 PICNIC TABLES 345228 MNTC1268617 3103.62523/16/2022 Parks & Play Area Supplies Site Amenity Maintenance 23.31 HARDWARE FOR NTP 345395 MNTC1268607 6146.62303/17/2022 Repair/Maintenance Supplies-Ge North Plant Building 74.08 HARDWARE FOR NTP 345396 MNTC1268633 6146.62303/17/2022 Repair/Maintenance Supplies-Ge North Plant Building 314.89 225428 3/18/2022 160126 FAUL PSYCHOLOGICAL 1,850.00 NEW OFFICER PSYCHOLOGICAL 345229 1086 1101.63193/16/2022 Medical Services - Other General/Admn-Police 1,850.00 225429 3/18/2022 122976 FIRE SAFETY USA INC. 136.00 TRUCK DOOR ALARM MAGNETS 345386 157191 1224.62313/17/2022 Mobile Equipment Repair Parts Engineer 347.50 E2 SERVICE 345387 157193 1224.64253/17/2022 Mobile Equipment Repair Labor Engineer 483.50 225430 3/18/2022 143971 FLEETPRIDE 34.91 WO 243 345230 94080867 9001.14153/16/2022 Inventory - Parts General Fund 3/18/2022City of Eagan 10:41:43R55CKR2LOGIS102V 5Page -Council Check Register by GL Check Register w GL Date & Summary 3/18/20223/14/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225430 3/18/2022 143971 FLEETPRIDE Continued... 677.52 WO 2022-242 345231 93927151 9001.14153/16/2022 Inventory - Parts General Fund 712.43 225431 3/18/2022 159942 FLOUR POWER 10.00 3/9/22 MARKET - SNAP/EBT 345232 030922 3061.6220 PR0033/16/2022 Operating Supplies - General Market Fest 10.00 225432 3/18/2022 140634 FRATTALONE AND ASSOCIATES INC. 1,142.50 WIRE FOR SOUND SYSTEM 345347 15090 6603.62333/17/2022 Building Repair Supplies Building Repair & Maint. 1,138.35 WIRE FOR SOUND SYSTEM 345348 15091 6603.62333/17/2022 Building Repair Supplies Building Repair & Maint. 2,280.85 225433 3/18/2022 147955 GALLS LLC 45.90 UNIFORM HONOR GUARD 345233 020579490 1104.62243/16/2022 Clothing/Personal Equipment Patrolling/Traffic 66.58 UNIFORM KRITZECK 345234 020554200 1104.62243/16/2022 Clothing/Personal Equipment Patrolling/Traffic 94.84 UNIFORM NEW OFFICERS 345235 020607620 1104.62243/16/2022 Clothing/Personal Equipment Patrolling/Traffic 93.60 UNIFORM NEW OFFICERS 345236 020609197 1104.62243/16/2022 Clothing/Personal Equipment Patrolling/Traffic 294.48 UNIFORM NEW OFFICERS 345237 020623802 1104.62243/16/2022 Clothing/Personal Equipment Patrolling/Traffic 71.50 UNIFORM MOSENG 345238 020625789 1104.62243/16/2022 Clothing/Personal Equipment Patrolling/Traffic 71.50-UNIFORM MOSENG 345239 020627307 1104.62243/16/2022 Clothing/Personal Equipment Patrolling/Traffic 147.24 UNIFORM SUNDGAARD 345240 020634862 1104.62243/16/2022 Clothing/Personal Equipment Patrolling/Traffic 71.50 UNIFORM MOSENG 345241 020634877 1104.62243/16/2022 Clothing/Personal Equipment Patrolling/Traffic 122.40 UNIFORM NEW OFFICERS 345242 020655135 1104.62243/16/2022 Clothing/Personal Equipment Patrolling/Traffic 448.32 UNIFORM NEW OFFICERS 345243 020641054 1104.62243/16/2022 Clothing/Personal Equipment Patrolling/Traffic 103.80 UNIFORM NEW OFFICERS 345244 020641563 1104.62243/16/2022 Clothing/Personal Equipment Patrolling/Traffic 150.00 UNIFORM NEW OFFICERS 345245 020641914 1104.62243/16/2022 Clothing/Personal Equipment Patrolling/Traffic 50.00 UNIFORM MEYER 345246 020644370 1104.62243/16/2022 Clothing/Personal Equipment Patrolling/Traffic 30.00 UNIFORM NEW OFFICERS 345247 020644379 1104.62243/16/2022 Clothing/Personal Equipment Patrolling/Traffic 1,718.66 225434 3/18/2022 100990 GRAINGER 110.55 HARDWARE FOR NTP 345397 9239082077 6146.62333/17/2022 Building Repair Supplies North Plant Building 110.55 225435 3/18/2022 160221 HAPPYFOX INC 5,961.60 IT HELPDESK SOFTWARE 345248 467AA545-0002 0301.65693/16/2022 Maintenance Contracts IT-Gen & Admn 5,961.60 225436 3/18/2022 100085 HARDWARE HANK 34.13 RECYCLING SIGNS 345249 2023937 3103.62573/16/2022 Signs & Striping Material Site Amenity Maintenance 3/18/2022City of Eagan 10:41:43R55CKR2LOGIS102V 6Page -Council Check Register by GL Check Register w GL Date & Summary 3/18/20223/14/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225436 3/18/2022 100085 HARDWARE HANK Continued... 34.13 225437 3/18/2022 152930 HARRIS MECHANICAL SERVICES LLC 10,913.25 MAINT AGREEMENT 345349 505012861 6602.65693/17/2022 Maintenance Contracts Equipment Repair & Maint. 10,913.25 225438 3/18/2022 146906 HASTINGS POLICE DEPARTMENT 583.96 12-DC-1222 DEC 2021 345350 030822 9695.6580 AHT213/17/2022 Reimb to Cities & Counties Dakota Co Drug Task Force 583.96 225439 3/18/2022 121622 HASTINGS, CITY OF 7,993.22 GIPSON 1/31-2/27/22 345351 202203095910 9699.63103/17/2022 Professional Services-General DCDTF state grant 7,993.22 225440 3/18/2022 100267 HAYES ELECTRIC 831.22 ELECTRICAL WORK 345250 4581 3314.65353/16/2022 Other Contractual Services Central Maintenance 1,800.00 R&R LED CONVERSION PARKS 345251 4585 3624.66203/16/2022 Buildings Facilities R&R Fd-Mtn Facility 597.92 ELECTRIC SERVICE UPGRADES 345388 4586 6501.65353/17/2022 Other Contractual Services G/A - Water Quality 3,229.14 225441 3/18/2022 138631 HEALTHEAST MEDICAL TRANSPORTATION 88.40 BLOOD DRAW 345252 22-11477 9115.63103/16/2022 Professional Services-General DWI Forfeiture 88.40 225442 3/18/2022 102599 HIRSHFIELD'S PAINT MANUFACTURING 3,972.10 FIELD PAINT 345253 0010234-IN-0519 21 3118.62513/16/2022 Athletic Field Supplies Athletic Field Mtn/Setup 3,972.10 225443 3/18/2022 138907 HOLMIN HEATING & COOLING 550.00 BRIDLE FURNACE MOTOR 345254 705029 3106.62333/16/2022 Building Repair Supplies Structure Care & Maintenance 550.00 225444 3/18/2022 141048 HORNSTEIN, CHERYL 446.59 FALL MUSIC PAYMENT 345255 1-031022 3057.63203/16/2022 Instructors Preschool Programs 446.59 225445 3/18/2022 104674 INDELCO PLASTICS CORP. 26.86 NTP NAMN04 DAY TANK PART 345398 INV313302 6147.62303/17/2022 Repair/Maintenance Supplies-Ge North Plant Production 90.79 CL2 BALL VALVES 345399 INV313408 6147.62303/17/2022 Repair/Maintenance Supplies-Ge North Plant Production 3/18/2022City of Eagan 10:41:43R55CKR2LOGIS102V 7Page -Council Check Register by GL Check Register w GL Date & Summary 3/18/20223/14/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225445 3/18/2022 104674 INDELCO PLASTICS CORP.Continued... 1,315.64 CL2 SUPPLIES AND NAMN04 345400 INV313897 6147.62603/17/2022 Utility System Parts/Supplies North Plant Production 1,473.72 FL2 PUMP 345401 INV314154 6147.62603/17/2022 Utility System Parts/Supplies North Plant Production 191.54 NAMN04 PARTS 345402 INV314564 6147.62303/17/2022 Repair/Maintenance Supplies-Ge North Plant Production 3,098.55 225446 3/18/2022 151879 JOHNSON CONTROLS FIRE PROTECTION LP 502.12 FIRE ALARM MONITORING 345256 22800827 6827.65693/16/2022 Maintenance Contracts Building Maintenance 502.12 225447 3/18/2022 153563 JOHNSON FITNESS AND WELLNESS 12,512.20 JOHNSON FIT - (2) STAIRMILLS 345382 22-038376 6807.66403/17/2022 Machinery/Equipment Fitness Center 12,512.20 225448 3/18/2022 119878 KATH FUEL 24,389.25 CITY UNLEAD 345257 738240 9001.14113/16/2022 Inventory - Motor Fuels General Fund 24,389.25 225449 3/18/2022 150339 LAKE MANAGEMENT INC. 1,218.14 WATER QUALITY/RESOURCE MGMT 345258 41241 3126.65353/16/2022 Other Contractual Services Water Quality/Resource Mgmt 1,218.14 225450 3/18/2022 131038 LANDS END BUSINESS OUTFITTERS 110.85 UNIFORM SUPPORT STAFF 345259 S1N9997205 1107.62243/16/2022 Clothing/Personal Equipment Support Services 110.85 225451 3/18/2022 156856 LYNCH CAMPS INC 1,667.20 LYNCH PICKLEBALL LESSONS 345264 022822 6810.63103/16/2022 Professional Services-General Gymnasium 1,667.20 225452 3/18/2022 100116 MACQUEEN EQUIP 7,566.24 CCTV CAMERA REPAIRS 345265 W09843 6240.64253/16/2022 Mobile Equipment Repair Labor Sewer Main Inspection 7,566.24 225453 3/18/2022 133443 MARTIN COMPANY, JEFF 340.00 NV BALLFIELD LIGHTS 345266 10188 3109.64283/16/2022 Field/Other Equipment Repair-L Lighting Maintenance 340.00 225454 3/18/2022 100571 MENARDS-APPLE VALLEY 350.10 PICNIC TABLE REPAIR BOARDS 345267 32147 3103.62523/16/2022 Parks & Play Area Supplies Site Amenity Maintenance 36.64 BENCH REPAIR BOLTS 345268 32004 3103.62523/16/2022 Parks & Play Area Supplies Site Amenity Maintenance 3/18/2022City of Eagan 10:41:43R55CKR2LOGIS102V 8Page -Council Check Register by GL Check Register w GL Date & Summary 3/18/20223/14/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225454 3/18/2022 100571 MENARDS-APPLE VALLEY Continued... 386.74 225455 3/18/2022 160163 MIDWEST MACHINERY CO 80.52 WO 227 345269 9043820 9001.14153/16/2022 Inventory - Parts General Fund 80.52 225456 3/18/2022 160208 MINUTEMAN PRESS 639.83 PRAIRIE BURN SIGNS 345270 2837338 3223.62203/16/2022 Operating Supplies - General Natural Resource Mgmt 639.83 225457 3/18/2022 149684 MISSION CRITICAL CONCEPTS 790.00 TRAINING FEES 345271 MCC# DS-P-22 1104.64763/16/2022 Conferences/Meetings/Training Patrolling/Traffic 790.00 225458 3/18/2022 100664 MN CHILD SUPPORT 682.27 PAYROLL ENDING 3/12/22 345360 GARNISHMENT 3/12/22 9592.20303/18/2022 Ded Pay - Garnishments Benefit Accrual 246.42 PAYROLL ENDING 3/12/22 345361 GARNISHMENT 3/12/22-1 9592.20303/18/2022 Ded Pay - Garnishments Benefit Accrual 370.55 PAYROLL ENDING 3/12/22 345362 GARNISHMENT 3/12/22-2 9592.20303/18/2022 Ded Pay - Garnishments Benefit Accrual 1,299.24 225459 3/18/2022 102468 MN DEPT OF HEALTH 23.00 LICENSE RENEWAL-W. BOYD 345272 2022-BOYD 6101.64803/16/2022 Licenses, Permits and Taxes Water -Administration 23.00 225460 3/18/2022 102019 MN DEPT OF LABOR & INDUSTRY 100.00 ELEVATOR PERMIT 345273 ALR0133140X 3313.64803/16/2022 Licenses, Permits and Taxes Fire Buildings 200.00 ELEVATOR PERMIT 345274 ALR0132739X 3304.64803/16/2022 Licenses, Permits and Taxes Bldg/Facilities Maintenance 20.00 LICENSE RENEWAL-B. HEIL 345275 SP078728-22-HEI L 6101.64803/16/2022 Licenses, Permits and Taxes Water -Administration 320.00 225461 3/18/2022 120087 MN ENERGY RESOURCES CORP 593.12 FIRE SAFETY CENTER 345276 0507084666-0000 1-MAR22 3313.64103/16/2022 Natural Gas Service Fire Buildings 4,366.07 SOUTH TREATMENT PLANT 345277 0503582559-0000 1-MAR22 6154.64103/16/2022 Natural Gas Service South Plant Building 212.00 BRIDLE RIDGE PARK 345278 0502896570-0000 3106.64103/16/2022 Natural Gas Service Structure Care & Maintenance 3/18/2022City of Eagan 10:41:43R55CKR2LOGIS102V 9Page -Council Check Register by GL Check Register w GL Date & Summary 3/18/20223/14/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225461 3/18/2022 120087 MN ENERGY RESOURCES CORP Continued... 6-MAR22 220.27 ART HOUSE 345279 0506085756-0000 1-MAR22 3106.64103/16/2022 Natural Gas Service Structure Care & Maintenance 5,391.46 225462 3/18/2022 120715 MN OCCUPATIONAL HEALTH - LOCKBOX 135054 173.00 PREEMPLOYMENT PHYSICAL 345280 391443 1001.63183/16/2022 Medical Services - Physical Ex General/Admn-Human Resources 173.00 225463 3/18/2022 100146 MTI DISTR CO 45.04 PND WO FOR 329 345281 1336523-00 9001.14153/16/2022 Inventory - Parts General Fund 27.04 REPAIR PARTS FOR PUSH MOWER 345282 1336516-00 3127.62313/16/2022 Mobile Equipment Repair Parts Equipment Maintenance/Repair 27.04 PUSH MOWER REPAIR PARTS 345283 1336530-00 3127.62313/16/2022 Mobile Equipment Repair Parts Equipment Maintenance/Repair 659.20 FOUNTAIN SERVICE 345284 1336968-00 3109.64283/16/2022 Field/Other Equipment Repair-L Lighting Maintenance 758.32 225464 3/18/2022 143773 MUNICIPAL BUILDERS INC. 32,884.25 PLANT IMPROVEMENTS 345285 022822 6154.6630 P13783/16/2022 Other Improvements South Plant Building 32,884.25 225465 3/18/2022 143773 MUNICIPAL BUILDERS INC. 211,819.41 PLANT IMPROVEMENTS 345286 030422 6154.6630 P13783/16/2022 Other Improvements South Plant Building 211,819.41 225466 3/18/2022 106859 MUSCO SPORTS LIGHTING 899.80 RAHN RINK LIGHTS 345287 361801 3109.62343/16/2022 Field/Other Equipment Repair Lighting Maintenance 899.80 225467 3/18/2022 100149 NORTHERN TOOL 81.88 2022-124 345288 0035105529 9001.14153/16/2022 Inventory - Parts General Fund 204.88 SMALL REPAIR SUPPLIES 345289 0031315625 3127.62203/16/2022 Operating Supplies - General Equipment Maintenance/Repair 286.76 225468 3/18/2022 101667 NORTHWESTERN POWER EQUIP. CO. INC. 43,578.50 COACHMAN PRV STATION 345290 220048DJ 6152.66303/16/2022 Other Improvements PRS Inspection/Maint/Repair 43,578.50 225469 3/18/2022 156621 NTK EARTHWORKS LLC 14,981.84 DESTALLPLAYNTK CONTRACT 345291 6-022122 2811.67533/16/2022 Grading Woodhaven Park 14,981.84 3/18/2022City of Eagan 10:41:43R55CKR2LOGIS102V 10Page -Council Check Register by GL Check Register w GL Date & Summary 3/18/20223/14/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225469 3/18/2022 156621 NTK EARTHWORKS LLC Continued... 225470 3/18/2022 108599 OFFICE DEPOT, INC. 54.34 OFFICE SUPPLIES 345292 233319035001 2401.62103/16/2022 Office Supplies Gen/Adm-Central Services 417.46 OFFICE MAX - OFFICE SUPPLIES 345293 228887236001 3001.62103/16/2022 Office Supplies General/Admn-Recreation 10.22 OFFICE MAX - OFFICE SUPPLIES 345294 229104845001 3001.62103/16/2022 Office Supplies General/Admn-Recreation 5.69 OFFICE MAX - OFFICE SUPPLIES 345295 229104857001 3001.62103/16/2022 Office Supplies General/Admn-Recreation 37.57 OFFICE DEPOT, INC.345296 232147369001 1221.62203/16/2022 Operating Supplies - General Administration-Fire 90.76 OFFICE DEPOT, INC.345297 233384415001 1221.62203/16/2022 Operating Supplies - General Administration-Fire 8.80 OFFICE DEPOT, INC.345298 233387460001 1221.62203/16/2022 Operating Supplies - General Administration-Fire 52.31 OFFICE SUPPLIES 345299 230654591001 1107.62123/16/2022 Office Small Equipment Support Services 677.15 225471 3/18/2022 143709 OREILLY AUTO PARTS 6.99 TOOL FOR SHOP 345300 3287-312968 2401.62403/16/2022 Small Tools Gen/Adm-Central Services 6.99 225472 3/18/2022 102381 PARK SUPPLY, INC. 114.80 BRIDLE DRINKING FOUNTAIN 345302 263615 3106.62333/16/2022 Building Repair Supplies Structure Care & Maintenance 114.80 225473 3/18/2022 115253 PELLICCI ACE HARDWARE 16.25 RECYCLING SIGNS 345303 21601 /E 3103.62573/16/2022 Signs & Striping Material Site Amenity Maintenance 16.25 225474 3/18/2022 160218 PETERSON, RASHAL L 200.00 EAB - COST SHARE 345304 2022 EAB-ASH TREE REMOVAL 3209.68603/16/2022 Contributions/Cost Sharing Pay Plant Inspections-Private Prop 200.00 225475 3/18/2022 122946 PLUTA, LAWRENCE J. 175.00 CLOTHING ALLOWANCE-PLUTA 345305 030722 3170.21153/16/2022 Clothing Allowance General AdmIn-Parks 175.00 225476 3/18/2022 100361 R & R SPECIALTIES INC 150.00 BLADES SHARPENED 345352 0075383-IN 6602.65693/17/2022 Maintenance Contracts Equipment Repair & Maint. 150.00 225477 3/18/2022 143557 RANDSTAD (R) 1,368.19 ADMIN ASSIST 2/27-3/5/2022 345353 R30761818 9699.65613/17/2022 Temporary Help-Labor/Clerical DCDTF state grant 1,368.19 3/18/2022City of Eagan 10:41:43R55CKR2LOGIS102V 11Page -Council Check Register by GL Check Register w GL Date & Summary 3/18/20223/14/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225477 3/18/2022 143557 RANDSTAD (R)Continued... 225478 3/18/2022 141789 RED WING SHOE STORE 144.99 UNIFORM BOOTS - SCHNEIDER 345306 728-2-43451 1221.62243/16/2022 Clothing/Personal Equipment Administration-Fire 144.99 225479 3/18/2022 152980 REMTECH INC. PEST PROTECTION 173.60 NTP PEST CONTROL 345403 20182 6146.65353/17/2022 Other Contractual Services North Plant Building 108.50 STP PEST CONTROL 345404 20183 6154.65353/17/2022 Other Contractual Services South Plant Building 282.10 225480 3/18/2022 150405 RMB ENVIRONMENTAL LABORATORIES INC 90.00 WQ MONITORING ANALYSES 345389 B004671 6528.63233/17/2022 Testing Services Basin Mgmt-Water Spl/Studies/M 265.00 WQ MONITORING ANALYSES 345390 B004670 6528.63233/17/2022 Testing Services Basin Mgmt-Water Spl/Studies/M 355.00 225481 3/18/2022 144434 ROADKILL ANIMAL CONTROL 186.00 ROAD KILL PICK UP-FEB 22 345308 022822 2271.65353/16/2022 Other Contractual Services Boulevard/Ditch Mtn 186.00 225482 3/18/2022 139237 SAFARILAND LLC (R) 626.87 NIK TEST U E 345354 I010-422200 9699.62203/17/2022 Operating Supplies - General DCDTF state grant 626.87 225483 3/18/2022 149711 SAFE-FAST INC. 155.90 EAR PLUGS 345309 INV257606 6104.62223/16/2022 Medical/Rescue/Safety Supplies Safety 155.90 225484 3/18/2022 160209 SCHWANDT, MARY 11.00 ACTIVITY REFUND 345310 1618744 3001.22503/16/2022 Escrow Deposits General/Admn-Recreation 11.00 225485 3/18/2022 100191 SHERWIN WILLIAMS 87.86 PAINT 345311 7960-0 3304.62333/16/2022 Building Repair Supplies Bldg/Facilities Maintenance 87.86 225486 3/18/2022 160205 SIEKERT, BENJAMIN W & AMBER B 200.00 EAB - COST SHARE 345312 2022 EAB-ASH TREE REMOVAL 3209.68603/16/2022 Contributions/Cost Sharing Pay Plant Inspections-Private Prop 200.00 3/18/2022City of Eagan 10:41:43R55CKR2LOGIS102V 12Page -Council Check Register by GL Check Register w GL Date & Summary 3/18/20223/14/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225487 3/18/2022 141677 SOUTH ST PAUL, CITY OF Continued... 264.04 12-DC-1222 DEC 2021 345355 030822 9695.6580 AHT213/17/2022 Reimb to Cities & Counties Dakota Co Drug Task Force 264.04 OCDETF AUG 21 RAIN MAKER 345355 030822 9693.65803/17/2022 Reimb to Cities & Counties DCDTF OCDETF 528.08 225488 3/18/2022 148036 SPOK INC. 4.65 PAGER 345313 F0318109O 3301.63513/16/2022 Pager Service Fees General Management 4.65 225489 3/18/2022 100204 STREICHERS INC. 354.00 MULTI LAUNCHER AND SHIELD 345314 I1555814 1104.66703/16/2022 Other Equipment Patrolling/Traffic 1,176.00 VEST BOUGHTON 345315 I1556199 1144.62243/16/2022 Clothing/Personal Equipment Bullet Proof Vests grant 816.00 SWAT VESTS 345316 I1555944 3511.66703/16/2022 Other Equipment Equip Rev Fd-Dept 11 2,346.00 225490 3/18/2022 127800 SUPERIOR MECHANICAL COLLISION 2,213.06 LMC DEDCT CLAIM #114664 345356 38233 9591.63863/17/2022 Insurance Deductible Risk Management 2,213.06 225491 3/18/2022 151851 SYSCO-MINNESOTA INC 834.24 SYSCO - ECC BEVERAGES 345383 347929946 6831.68553/17/2022 Merchandise for Resale Food and Beverage 834.24 225492 3/18/2022 160223 THARALDSON, DEBRA 2.00 UB CREDIT BALANCE REFUND 345317 031522 6301.45503/16/2022 Street Light Service Charges Street Lighting 2.00 225493 3/18/2022 134135 THOMSON REUTERS 927.00 STATUTE BOOKS 345318 846037425 1104.62153/16/2022 Reference Materials Patrolling/Traffic 927.00 225494 3/18/2022 100107 THYSSENKRUPP ELEVATOR 142.23 MONTHLY FEES 345357 3006458281 6603.65693/17/2022 Maintenance Contracts Building Repair & Maint. 142.23 225495 3/18/2022 142973 T-MOBILE USA (R) 300.00 21-WS-4071 GPS LOCATE 345358 9487372143 9698.6589 H21013/17/2022 Forfeiture Expenditures DCDTF HIDTA 300.00 225496 3/18/2022 150730 TOLLEFSON FAMILY PORK 11.00 3/9/22 MARKET - SNAP/EBT 345319 030922 3061.6220 PR0033/16/2022 Operating Supplies - General Market Fest 3/18/2022City of Eagan 10:41:43R55CKR2LOGIS102V 13Page -Council Check Register by GL Check Register w GL Date & Summary 3/18/20223/14/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225496 3/18/2022 150730 TOLLEFSON FAMILY PORK Continued... 11.00 225497 3/18/2022 100223 TRI STATE BOBCAT 216.72 ARBORIST HELM. PARTS AND CHAPS 345320 P70976 3201.62203/16/2022 Operating Supplies - General Administrative/General 37.98 STIHL ARBORIST HELMET PARTS 345321 P71239 3201.62223/16/2022 Medical/Rescue/Safety Supplies Administrative/General 254.70 225498 3/18/2022 158131 TRP AMERICA 300.00 TRP RETENTION MANAGEMENT 345384 SUP037413 6807.65693/17/2022 Maintenance Contracts Fitness Center 300.00 225499 3/18/2022 100228 TWIN CITY GARAGE DOOR CO 206.13 GARAGE DOOR REPAIR 345322 Z205324 3314.65353/16/2022 Other Contractual Services Central Maintenance 1,745.00 GARAGE DOOR REPAIR 345323 Z205315 3314.65353/16/2022 Other Contractual Services Central Maintenance 1,951.13 225500 3/18/2022 100232 UHL CO INC 2,425.00 FIRE ALARM 345324 39914 3304.65693/16/2022 Maintenance Contracts Bldg/Facilities Maintenance 321.00 FIRE SYSTEM SERVICE CALL 345325 41227 0301.62303/16/2022 Repair/Maintenance Supplies-Ge IT-Gen & Admn 4,939.00 ADDITIONAL GARAGE SECURITY 345326 67790 6146.66303/16/2022 Other Improvements North Plant Building 7,685.00 225501 3/18/2022 158258 VANGUARD UTILITY SERVICE INC 15,609.64 AMI PROJECT 345327 4169 6162.6630 P14243/16/2022 Other Improvements Meter Reading 6,188.11 AMI PROJECT 345328 4108 6162.6630 P14243/16/2022 Other Improvements Meter Reading 21,797.75 225502 3/18/2022 100912 VERIZON WIRELESS, BELLEVUE 342.42 CELL PHONES-MOBILE COMMAND 2&3 345329 9901080777 1108.63553/16/2022 Cellular Telephone Service Communications 31.22 CELL PHONE-KITTELSON 345329 9901080777 0805.63553/16/2022 Cellular Telephone Service Construction Insp-Field 373.64 225503 3/18/2022 132847 VIKING AUTOMATIC SPRINKLER CO. 325.00 FIRE ALARM 345330 1025-F205685 3314.65353/16/2022 Other Contractual Services Central Maintenance 325.00 225504 3/18/2022 100237 VIKING ELECTRIC 1,874.80 R&R LED CONVERSION PARKS 345331 S005579615.001 3624.66203/16/2022 Buildings Facilities R&R Fd-Mtn Facility 257.38 WIRE FOR NTP 345405 S005551354.001 6147.62603/17/2022 Utility System Parts/Supplies North Plant Production 93.52 WIRE FOR CONTROLS 345406 S005581319.001 6147.62603/17/2022 Utility System Parts/Supplies North Plant Production 3/18/2022City of Eagan 10:41:43R55CKR2LOGIS102V 14Page -Council Check Register by GL Check Register w GL Date & Summary 3/18/20223/14/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225504 3/18/2022 100237 VIKING ELECTRIC Continued... 46.76 WIRE FOR CONTROLS 345407 S005587910.001 6147.62603/17/2022 Utility System Parts/Supplies North Plant Production 361.27 ELECT SUPPLIES FOR CONTROL BOX 345408 S005593304.001 6147.62403/17/2022 Small Tools North Plant Production 2,633.73 225505 3/18/2022 102663 WAYTEK, INC. 686.62 PD 345332 3312675 3511.66803/16/2022 Mobile Equipment Equip Rev Fd-Dept 11 686.62-RETURN PARTS - MISSING DEL 345333 3316696 3511.66803/16/2022 Mobile Equipment Equip Rev Fd-Dept 11 646.07 REPLACEMENT ORDER 345334 3316957 3511.66803/16/2022 Mobile Equipment Equip Rev Fd-Dept 11 646.07 225506 3/18/2022 101834 WEST ST. PAUL, CITY OF 412.92 OCDETF OCT 21 FAMILY TYES 345359 030822 9693.65803/17/2022 Reimb to Cities & Counties DCDTF OCDETF 412.92 225507 3/18/2022 116252 WESTERMAYER, DAVE 205.05 WESTERMAYER-WORK BOOTS 345335 030722 2010.62243/16/2022 Clothing/Personal Equipment General Engineering 205.05 225508 3/18/2022 113476 WISCONSIN SUPPORT COLLECTIONS TRUST FUND 363.81 PAYROLL ENDING 3/12/22 345363 GARNISHMENT 3/12/22 9592.20303/18/2022 Ded Pay - Garnishments Benefit Accrual 363.81 225509 3/18/2022 101755 XCEL ENERGY 242.40 VIKINGS PKWY CONTROLLER P 345336 51-0011993854-9 -022822 6301.64063/16/2022 Electricity-Street Lights Street Lighting 242.40 225510 3/18/2022 101755 XCEL ENERGY 280.85 VIKINGS PKWY CONTROLLER Q 345337 51-0011994568-4 -022822 6301.64063/16/2022 Electricity-Street Lights Street Lighting 280.85 225511 3/18/2022 101755 XCEL ENERGY 79.28 QUARRY PARK 345338 51-6563384-1-03 0422 3106.64053/16/2022 Electricity Structure Care & Maintenance 35.62-MCKEE ST ICE RINK LIGHTS 345338 51-6563384-1-03 0422 3104.64053/16/2022 Electricity Site Amenity Installation 13.13 SKYLINE RD HOCKEY RINK 345338 51-6563384-1-03 0422 3104.64053/16/2022 Electricity Site Amenity Installation 3/18/2022City of Eagan 10:41:43R55CKR2LOGIS102V 15Page -Council Check Register by GL Check Register w GL Date & Summary 3/18/20223/14/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225511 3/18/2022 101755 XCEL ENERGY Continued... 56.79 225512 3/18/2022 101755 XCEL ENERGY 344.77 CONCESSION STAND 345339 51-6563391-0-03 0422 3106.64053/16/2022 Electricity Structure Care & Maintenance 166.40-BAND SHELL 345339 51-6563391-0-03 0422 3106.64053/16/2022 Electricity Structure Care & Maintenance 18.97 CENTRAL PARK PUMP STATION 345339 51-6563391-0-03 0422 3186.64053/16/2022 Electricity Recreation Program Support 271.10 FESTIVAL GROUNDS 345339 51-6563391-0-03 0422 3106.64053/16/2022 Electricity Structure Care & Maintenance 1,485.94 WELL #20 345339 51-6563391-0-03 0422 6148.64093/16/2022 Electricity-Wells/Booster Stat North Well Field 9,554.72 ECC NATURAL GAS 345339 51-6563391-0-03 0422 6824.64103/16/2022 Natural Gas Service Utilities 4,190.98-ECC ELECTRICITY 345339 51-6563391-0-03 0422 6824.64053/16/2022 Electricity Utilities 7,318.12 225513 3/18/2022 101755 XCEL ENERGY 927.15 SIGNALS 345340 51-6563386-3-03 0422 6301.64073/16/2022 Electricity-Signal Lights Street Lighting 927.15 1000222 3/18/2022 159870 FARMING GARDENS 11.00 3/9/22 MARKET - SNAP/EBT 345227 030922 3061.6220 PR0033/16/2022 Operating Supplies - General Market Fest 11.00 1000223 3/18/2022 100111 LOGIS 71,754.25 SOFTWARE MAINTENANCE 345260 51797 0301.63503/16/2022 LOGIS IT Services IT-Gen & Admn 390.00 LOGIS NETWORK SERVICES 345261 51759 0301.63503/16/2022 LOGIS IT Services IT-Gen & Admn 404.30 INTERNET FEES 345262 51888 0301.63503/16/2022 LOGIS IT Services IT-Gen & Admn 120.00 ENTRUST TOKENS 345263 51854 0301.62103/16/2022 Office Supplies IT-Gen & Admn 404.30 INTERNET FEES 345263 51854 0301.63503/16/2022 LOGIS IT Services IT-Gen & Admn 499.10 LASERFICHE SOFT MAINT 345263 51854 0901.64963/16/2022 Historical Society Gen & Admin-Communications 73,571.95 1000224 3/18/2022 159719 PAPA BEARS JAMS 10.00 3/9/22 MARKET - MARKETBUCKS 345301 030922 3061.6220 PR0043/16/2022 Operating Supplies - General Market Fest 18.00 3/9/22 MARKET - SNAP/EBT 345301 030922 3061.6220 PR0033/16/2022 Operating Supplies - General Market Fest 3/18/2022City of Eagan 10:41:43R55CKR2LOGIS102V 16Page -Council Check Register by GL Check Register w GL Date & Summary 3/18/20223/14/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 1000224 3/18/2022 159719 PAPA BEARS JAMS Continued... 28.00 1000225 3/18/2022 148896 RISHEL, THOMAS G 13.00 CLOTHING ALLOWANCE - RISHEL 345307 02/24/22 6101.21153/16/2022 Clothing Allowance Water -Administration 13.00 20220313 3/18/2022 100693 EAGAN PAYROLL ACCT 864,061.74 PAYROLL ENDING 3/12/22 345373 031722 9001.11153/18/2022 Claim on Cash General Fund 2,609.80 PAYROLL ENDING 3/12/22 345373 031722 9111.11153/18/2022 Claim on Cash Tree mitigation 11,021.88 PAYROLL ENDING 3/12/22 345373 031722 9197.11153/18/2022 Claim on Cash ETV 89,852.44 PAYROLL ENDING 3/12/22 345373 031722 9220.11153/18/2022 Claim on Cash Public Utilities 20,645.07 PAYROLL ENDING 3/12/22 345373 031722 9221.11153/18/2022 Claim on Cash Civic Arena 1,713.58 PAYROLL ENDING 3/12/22 345373 031722 9222.11153/18/2022 Claim on Cash Cascade Bay 37,515.65 PAYROLL ENDING 3/12/22 345373 031722 9223.11153/18/2022 Claim on Cash Central Park/Community Center 135,018.98 PAYROLL ENDING 3/12/22 345373 031722 9592.11153/18/2022 Claim on Cash Benefit Accrual 54,178.36 PAYROLL ENDING 3/12/22 345373 031722 9592.61443/18/2022 FICA Benefit Accrual 1,216,617.50 20220314 3/18/2022 100249 FIT 158,282.51 PAYROLL ENDING 3/12/22 345374 031822 9880.20113/18/2022 Ded Payable - FIT Payroll 158,282.51 20220315 3/18/2022 100250 COMMISIONER OF REVENUE-PAYROLL 45,619.55 PAYROLL ENDING 3/12/22 345375 031822 9880.20123/18/2022 Ded Payable - SIT Payroll 45,619.55 20220316 3/18/2022 100252 FICA 38,555.32 PAYROLL ENDING 3/12/22 345376 031822 9880.20143/18/2022 Ded Payable - FICA Payroll 38,555.32 20220317 3/18/2022 100253 MEDICARE 15,623.04 PAYROLL ENDING 3/12/22 345377 031822 9880.20153/18/2022 Ded Payable - Medicare Payroll 15,623.04 20220318 3/18/2022 150536 MONEY MOVERS INC. 70.00 FEBRUARY 2022 345364 146391 6807.43213/18/2022 Memberships-Taxable Fitness Center 70.00 20222506 3/18/2022 115374 MN STATE RETIREMENT SYSTEM-HCSP 34,551.12 EMPLOYEE CONTRIBUTIONS 345365 031822 9592.20343/18/2022 Ded Payable-HCSP Benefit Accrual 3/18/2022City of Eagan 10:41:43R55CKR2LOGIS102V 17Page -Council Check Register by GL Check Register w GL Date & Summary 3/18/20223/14/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 20222506 3/18/2022 115374 MN STATE RETIREMENT SYSTEM-HCSP Continued... 34,551.12 20223206 3/18/2022 138969 MN STATE RETIREMENT SYSTEM-MNDCP 13,678.23 EMPLOYEE CONTRIBUTIONS 345366 031822 9592.20323/18/2022 Ded Pay - Great West Def Comp Benefit Accrual 13,678.23 20224206 3/18/2022 100892 ICMA RETIREMENT TRUST 47,805.51 EMPLOYEE CONTRIBUTIONS 345367 031822 9592.20313/18/2022 Ded Pay - ICMA Benefit Accrual 47,805.51 20225103 3/18/2022 100283 BERKLEY ADMINISTRATORS 3,167.00 ADMIN FEE-FEBRUARY 2022 345368 031822 9593.63873/18/2022 Worker's Comp - Administration Workers' Compensation Self-In 3,167.00 20225611 3/18/2022 147907 SELECT ACCOUNT 6,676.23 FLEX REIMBURSEMENT 345369 031522 9592.22153/18/2022 Flex Plan Withholding Payable Benefit Accrual 6,676.23 20225805 3/18/2022 147907 SELECT ACCOUNT 250.00 VEBA CONT-MANDERS/SODERSTROM 345370 031022 9592.61593/18/2022 VEBA Benefit Accrual 250.00 20228006 3/18/2022 100694 PUBLIC EMPLOYEE RETIREMENT 76.96 PAYROLL PERIOD 2/27/22-3/12/22 345371 434600-031222 9592.61463/18/2022 PERA - DCP Benefit Accrual 100,450.30 PAYROLL PERIOD 2/27/22-3/12/22 345371 434600-031222 9592.20133/18/2022 Ded Payable - PERA Benefit Accrual 49,336.01 PAYROLL PERIOD 2/27/22-3/12/22 345371 434600-031222 9592.61423/18/2022 PERA - Coordinated Benefit Accrual 86,423.43 PAYROLL PERIOD 2/27/22-3/12/22 345371 434600-031222 9592.61433/18/2022 PERA - Police Benefit Accrual 236,286.70 20228512 3/18/2022 151185 HEALTHPARTNERS INC 3,486.05 DENTAL CLAIMS REIMBURSEMENT 345409 03142022 9594.61583/18/2022 Dental Insurance Dental Self-insurance 3,486.05 2,454,946.16 Grand Total Payment Instrument Totals Checks 2,381,322.21 73,623.95A/P ACH Payment Total Payments 2,454,946.16 3/18/2022City of Eagan 10:41:47R55CKS2LOGIS100 1Page -Council Check SummaryNote: Payment amount may not reflect the actual amount due to data sequencing and/or data selection. 3/18/20223/14/2022 - Company Amount 1,072,984.5509001GENERAL FUND 13,059.8009111Tree mitigation 88.4009115DWI Forfeiture 11,021.8809197ETV 431,653.6509220PUBLIC UTILITIES 34,273.7709221CIVIC ARENA 1,713.5809222CASCADE BAY 58,775.2309223CENTRAL PARK /COMMUNITY CENTER 14,981.8409328PARK SYS DEV AND R&R 1,462.0709335EQUIPMENT REVOLVING 3,674.8009336GENERAL FACILITIES RENEW & REP 2,213.0609591RISK MANAGEMENT 530,108.1809592BENEFIT ACCRUAL 3,167.0009593WORKERS' COMPENSATION SELF-INS 3,486.0509594Dental Self-insurance 14,201.8809695DAK CO DRUG TASK FORCE 258,080.4209880PAYROLL Report Totals 2,454,946.16 3/24/2022City of Eagan 16:49:19R55CKR2 LOGIS102V 1Page -Council Check Register by GL Check Register w GL Date & Summary 3/25/20223/21/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225514 3/25/2022 100005 ABM EQUIPMENT & SUPPLY 744.48 COMM. FOR 330 345684 0170213-IN 9001.14153/23/2022 Inventory - Parts General Fund 744.48 225515 3/25/2022 156129 ACROSS THE STREET PRODUCTIONS 4,143.75 BLUE CARD 345685 INV10274 1221.63203/23/2022 Instructors Administration-Fire 4,143.75 225516 3/25/2022 147198 ADVANCED ENGINEERING AND ENVIRONMENTAL 7,578.75 SEWER EVALUATION 345686 79627 6240.63103/23/2022 Professional Services-General Sewer Main Inspection 508.00 CROSS CONNECTION CONTROL PRG 345687 79467 6113.63103/23/2022 Professional Services-General Preparation/ Research/ Writing 8,086.75 225517 3/25/2022 148129 AMAZON 329.00 DRONE EQUIP 345847 454649833446 1104.62263/25/2022 Public Safety Supplies Patrolling/Traffic 185.98 BAR STOOLS-MECHANICS OFFICE 345848 675478866798 2401.66603/25/2022 Office Furnishings & Equipment Gen/Adm-Central Services 129.00 SPEAKERS FOR CASE MGMT 345849 435963994534 1104.62263/25/2022 Public Safety Supplies Patrolling/Traffic 28.17 OFFICE SUPPLIES 345850 465789445864 6101.62103/25/2022 Office Supplies Water -Administration 29.97 BALLOONS 345851 798943987898 3079.62273/25/2022 Recreation Equipment/Supplies Special Events 25.99 SUPPLIES 345852 759845989376 0301.66603/25/2022 Office Furnishings & Equipment IT-Gen & Admn 15.98 SUPPLIES 345853 785566597789 0301.66603/25/2022 Office Furnishings & Equipment IT-Gen & Admn 79.10 PLOW MARKERS 345854 996639864453 2244.62313/25/2022 Mobile Equipment Repair Parts Street Equipment Repair/Mtn 36.87 WHITE KRAFT PAPER 345855 866799469464 3071.62273/25/2022 Recreation Equipment/Supplies MN State Arts Board 193.10 BOSU/BARBELL CLAMPS 345856 457955687759 6807.62203/25/2022 Operating Supplies - General Fitness Center 29.14 FIREARM RANGE SUPPLIES 345857 533375449598 1104.62263/25/2022 Public Safety Supplies Patrolling/Traffic 52.91 SUPPLIES 345858 768994935768 3071.62273/25/2022 Recreation Equipment/Supplies MN State Arts Board 57.27 FACE MASKS 345859 987533739885 6101.62223/25/2022 Medical/Rescue/Safety Supplies Water -Administration 54.11 WIRELESS KEYBOARD/MOUSE 345860 465355569966 2401.62103/25/2022 Office Supplies Gen/Adm-Central Services 20.97 CABLE 345861 854843367863 6101.62103/25/2022 Office Supplies Water -Administration 580.27 UNIT 112 345862 457783355484 9001.14153/25/2022 Inventory - Parts General Fund 231.50 FIREARM RANGE SUPPLIES 345863 589684885683 1104.62263/25/2022 Public Safety Supplies Patrolling/Traffic 39.99 UNIT 122-HEADLIGHT BULBS 345864 454697889765 9001.14153/25/2022 Inventory - Parts General Fund 275.00 CREDIT CARD TERMINAL 345865 456678433836 3001.66603/25/2022 Office Furnishings & Equipment General/Admn-Recreation 211.64 VIDEO EVIDENCE STORAGE 345866 574774467787 1107.62203/25/2022 Operating Supplies - General Support Services 274.41 DRONE SUPPLIES 345866 574774467787 1104.66703/25/2022 Other Equipment Patrolling/Traffic 13.98 EARPHONE TIPS 345867 844947536843 2401.62103/25/2022 Office Supplies Gen/Adm-Central Services 28.99 DRONE SUPPLIES 345868 865678573536 1104.62263/25/2022 Public Safety Supplies Patrolling/Traffic 38.94 CELL PHONE CASES 345869 458537433376 1104.62203/25/2022 Operating Supplies - General Patrolling/Traffic 10.95 CELL PHONE CASE 345869 458537433376 1105.62203/25/2022 Operating Supplies - General Investigation/Crime Prevention 35.98 TRAIL CAM CARDS 345869 458537433376 1105.62203/25/2022 Operating Supplies - General Investigation/Crime Prevention 173.56 MAG CUFFS 345870 968888793346 1104.62243/25/2022 Clothing/Personal Equipment Patrolling/Traffic 3-28-22 3/24/2022City of Eagan 16:49:19R55CKR2LOGIS102V 2Page -Council Check Register by GL Check Register w GL Date & Summary 3/25/20223/21/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225517 3/25/2022 148129 AMAZON Continued... 25.96 BATTERIES 345871 574859455975 6101.62103/25/2022 Office Supplies Water -Administration 68.07 SUPPLIES 345872 679433974368 6501.62203/25/2022 Operating Supplies - General G/A - Water Quality 86.75 SUPPLIES 345873 798657738979 3079.62273/25/2022 Recreation Equipment/Supplies Special Events 25.97 ICE FISHING CLINIC SUPPLIES 345874 973597599466 6538.62273/25/2022 Recreation Equipment/Supplies Pub Information/Education 22.98 LAPTOP SHOULDER BAG 345875 435868676765 6101.62103/25/2022 Office Supplies Water -Administration 134.10 UNITS 550,505,301 345876 559569587857 9001.14153/25/2022 Inventory - Parts General Fund 14.89 SUPPLIES 345877 799477738973 3081.62273/25/2022 Recreation Equipment/Supplies Arts & Humanities Council 26.41 PLOW CONTROL STRAPS 345878 976975456555 2244.62313/25/2022 Mobile Equipment Repair Parts Street Equipment Repair/Mtn 39.99 HEADSET 345879 464486868664 6801.62103/25/2022 Office Supplies General & Administrative 30.98 ICE CLEATS 345880 578394996498 3120.62223/25/2022 Medical/Rescue/Safety Supplies Ice Surface Estab & Mtn 30.35 REPLACEMENT BATTERIES 345881 668755536434 1104.62203/25/2022 Operating Supplies - General Patrolling/Traffic 95.28 HOSE FOR SQUAD BUILD AREA 345882 675345847994 2401.62403/25/2022 Small Tools Gen/Adm-Central Services 53.52 CSO ALUMINUM CLIPBOARDS 345883 753338868885 1104.62203/25/2022 Operating Supplies - General Patrolling/Traffic 16.78 SUPPLIES 345884 635849383776 3057.62273/25/2022 Recreation Equipment/Supplies Preschool Programs 16.99 SUPPLIES 345884 635849383776 3082.62273/25/2022 Recreation Equipment/Supplies Creative Camps 34.66 SUPPLIES 345884 635849383776 3082.62273/25/2022 Recreation Equipment/Supplies Creative Camps 139.99 NEW JUMP STARTER 345885 437475353764 1104.62203/25/2022 Operating Supplies - General Patrolling/Traffic 29.99-ENVELOPES RETURN 345886 464885878555 0501.62103/25/2022 Office Supplies General & Admn-Finance 29.99-ENVELOPES RETURN 345887 758549876549 0501.62103/25/2022 Office Supplies General & Admn-Finance 61.16 RANGE SUPPLIES 345888 945539976545 1104.62283/25/2022 Ammunition Patrolling/Traffic 299.00 SWAT MEDIC PULSE OXIMETER 345889 634497573567 1104.62243/25/2022 Clothing/Personal Equipment Patrolling/Traffic 10.56 RANGE SUPPLIES 345890 975444448784 1104.62283/25/2022 Ammunition Patrolling/Traffic 54.35 SUPPLIES 345891 947945846658 3071.62273/25/2022 Recreation Equipment/Supplies MN State Arts Board 219.89 SUPPLIES 345892 973856556897 0301.66603/25/2022 Office Furnishings & Equipment IT-Gen & Admn 40.95 RUBBER BANDS 345893 445748537598 3111.62233/25/2022 Building/Cleaning Supplies Refuse/Waste Control 35.96 POWER ADAPTERS 345894 444966853997 0301.66603/25/2022 Office Furnishings & Equipment IT-Gen & Admn 1,224.95 DOCKING STATIONS 345895 453749874883 3001.66603/25/2022 Office Furnishings & Equipment General/Admn-Recreation 244.99 DOCKING STATION 345895 453749874883 6601.66603/25/2022 Office Furnishings & Equipment General/Administrative-Arena 489.98 DOCKING STATIONS 345895 453749874883 6716.66603/25/2022 Office Furnishings & Equipment General Administration 226.88 FILTERS 345896 466983389683 3106.62333/25/2022 Building Repair Supplies Structure Care & Maintenance 25.99 HEADPHONE 345897 649768836447 6801.62203/25/2022 Operating Supplies - General General & Administrative 1,186.89 MAG DRILL 345898 766474363596 2401.66703/25/2022 Other Equipment Gen/Adm-Central Services 39.98-BOOKCASE RETURN 345899 877783845838 3057.62273/25/2022 Recreation Equipment/Supplies Preschool Programs 244.99 DOCKING STATION 345900 437886654368 0901.66603/25/2022 Office Furnishings & Equipment Gen & Admin-Communications 244.99 DOCKING STATION 345901 999395573634 0901.66603/25/2022 Office Furnishings & Equipment Gen & Admin-Communications 9.89 USB ADAPTER 345902 636659376385 6101.62103/25/2022 Office Supplies Water -Administration 830.00 SCANNER 345903 774846568394 1001.66603/25/2022 Office Furnishings & Equipment General/Admn-Human Resources 49.49 PAPER 345904 866685548694 6101.62103/25/2022 Office Supplies Water -Administration 106.42 SUPPLIES 345905 433687346753 2201.62203/25/2022 Operating Supplies - General Gen/Adm-Streets 3/24/2022City of Eagan 16:49:19R55CKR2LOGIS102V 3Page -Council Check Register by GL Check Register w GL Date & Summary 3/25/20223/21/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225517 3/25/2022 148129 AMAZON Continued... 49.85 CABLE TIES 345906 437798744977 6501.62203/25/2022 Operating Supplies - General G/A - Water Quality 279.96 MONITORS-THOM/GRANNES 345907 546889597693 2401.66603/25/2022 Office Furnishings & Equipment Gen/Adm-Central Services 21.98 CELL PHONE HOLDER-AITKIN 345908 764788485493 2201.62203/25/2022 Operating Supplies - General Gen/Adm-Streets 101.19 BATTERIES 345909 834658454477 1104.62203/25/2022 Operating Supplies - General Patrolling/Traffic 10.58 CABLE FOR NEW MONITOR-AG 345910 875677477373 2401.66603/25/2022 Office Furnishings & Equipment Gen/Adm-Central Services 55.96 PRESENTATION POINTERS 345911 885583994644 1106.62203/25/2022 Operating Supplies - General Emergency preparedness 31.85 WIRELESS MOUSE-BRIEFCASE 345912 455689447447 1221.62103/25/2022 Office Supplies Administration-Fire 106.42 HEADSET-A GRANNES 345913 479393359849 2401.66603/25/2022 Office Furnishings & Equipment Gen/Adm-Central Services 24.88 LAPTOP CASE 345914 578579387557 2401.62103/25/2022 Office Supplies Gen/Adm-Central Services 125.95 KEYBOARD/MOUSE/PP CLICKERS 345915 764378637838 1104.62263/25/2022 Public Safety Supplies Patrolling/Traffic 92.39 OFFICE EQUIP 345916 875486978788 1107.62123/25/2022 Office Small Equipment Support Services 29.89 LAPTOP BAG 345917 634954346683 2401.62103/25/2022 Office Supplies Gen/Adm-Central Services 18.98 SUPPLIES 345918 786963638869 0301.66603/25/2022 Office Furnishings & Equipment IT-Gen & Admn 13.95 SCREEN PROTECTOR 345919 433485579969 0301.66603/25/2022 Office Furnishings & Equipment IT-Gen & Admn 129.30 SUPPLIES 345920 476746347389 6101.62103/25/2022 Office Supplies Water -Administration 28.97 SUPPLIES 345921 575588549943 0301.66603/25/2022 Office Furnishings & Equipment IT-Gen & Admn 18.89-LAPTOP BAG 345922 693999986577 2401.62103/25/2022 Office Supplies Gen/Adm-Central Services 71.96 BANKERS BOXES-OSBERG 345923 788479846635 0201.62103/25/2022 Office Supplies General & Admn-Admn 132.89 SUPPLIES 345924 836886846548 6101.62103/25/2022 Office Supplies Water -Administration 10,861.87 225518 3/25/2022 100360 APPLE FORD LINCOLN APPLE VALLEY 4,949.19 WO COMM. 1209 345688 A1CB719439 9001.14153/23/2022 Inventory - Parts General Fund 38.16 STOCK WIPER BLADES 345689 560980 9001.14153/23/2022 Inventory - Parts General Fund 459.77 WO 2022-271 345690 560932 9001.14153/23/2022 Inventory - Parts General Fund 24.78 WO 2022-278 345691 561016 9001.14153/23/2022 Inventory - Parts General Fund 229.90 WO 2022-276 345692 559958 9001.14153/23/2022 Inventory - Parts General Fund 5,701.80 225519 3/25/2022 160241 ARCO, LAURIE 250.00 PROGRAM SUPPLIES 345693 032022 3071.62273/23/2022 Recreation Equipment/Supplies MN State Arts Board 250.00 225520 3/25/2022 121083 ASPEN MILLS 55.68 345694 290026 1221.62243/23/2022 Clothing/Personal Equipment Administration-Fire 130.12 ASPEN MILLS 345695 290647 1221.62243/23/2022 Clothing/Personal Equipment Administration-Fire 485.70 CHIEF 3-CLASS A UNIFORM 345696 290650 1221.62243/23/2022 Clothing/Personal Equipment Administration-Fire 671.50 225521 3/25/2022 148777 BLACK & VEATCH CORPORATION 3/24/2022City of Eagan 16:49:19R55CKR2LOGIS102V 4Page -Council Check Register by GL Check Register w GL Date & Summary 3/25/20223/21/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225521 3/25/2022 148777 BLACK & VEATCH CORPORATION Continued... 1,662.50 STORM MODELING 345697 1367108 6406.63103/23/2022 Professional Services-General Preparation/ Research/ Writing 10,132.74 PLANT IMPROVEMENTS 345698 1367118 6154.6712 P13783/23/2022 Project - Engineering South Plant Building 11,795.24 225522 3/25/2022 152805 CANTEEN REFRESHMENT SERVICES 53.80 CANTEEN.BEVERAGESUPPLIES 345699 MSP41289 6802.68553/23/2022 Merchandise for Resale Banquet Room 53.80 225523 3/25/2022 151299 CINTAS 40.48 RUGS 345700 4113100453 3314.65693/23/2022 Maintenance Contracts Central Maintenance 49.20 RUGS 345701 4113100502 3315.65693/23/2022 Maintenance Contracts City Hall 37.44 RUGS 345702 4113100441 3316.65693/23/2022 Maintenance Contracts Police 127.12 225524 3/25/2022 100633 CNH ARCHITECTS 774.38 UTIL ADMIN RECONFIG 345703 2252 6101.6712 P14673/23/2022 Project - Engineering Water -Administration 774.38 225525 3/25/2022 142286 COMCAST 53.94 MONTHLY DUES 3/18-4/17/22 345704 877210508072454 1-030822 6603.63473/23/2022 Telephone Service & Line Charg Building Repair & Maint. 53.94 225526 3/25/2022 150880 CORE & MAIN LP 52.13 GASKETS FOR WELL 8 9 345980 Q433028 6148.62303/24/2022 Repair/Maintenance Supplies-Ge North Well Field 15,660.00 METER REPLACEMENT 345981 P852522 6161.62603/24/2022 Utility System Parts/Supplies Meter Replacement 1,528.37 CURBSTOP REPAIR 345982 Q490228 6130.62603/24/2022 Utility System Parts/Supplies Curb Stop Inspctn/Maint/Repair 17,240.50 225527 3/25/2022 152916 CORNERSTONE PARKING GROUP 332.00 ALLIED MECH FIX SNOW METER 711 345983 100501 9116.65353/24/2022 Other Contractual Services Cedar Grove Parking Garage 618.00 SEDGWICK HVAC REPAIR 90962 345983 100501 9116.65353/24/2022 Other Contractual Services Cedar Grove Parking Garage 1,627.50 RELIABLE SNOW REMOVE 2/24-25 345983 100501 9116.65353/24/2022 Other Contractual Services Cedar Grove Parking Garage 4,766.50 RELIABLE SNOW REMOVE 2/22-23 345983 100501 9116.65353/24/2022 Other Contractual Services Cedar Grove Parking Garage 3,393.25 RELIABLE SNOW REMOVE 2/10-11 345983 100501 9116.65353/24/2022 Other Contractual Services Cedar Grove Parking Garage 1,107.50 RELIABLE SNOW REMOVE 2/10-11 345983 100501 9116.65353/24/2022 Other Contractual Services Cedar Grove Parking Garage 927.50 RELIABLE SNOW REMOVE 2/4-2/7 345983 100501 9116.65353/24/2022 Other Contractual Services Cedar Grove Parking Garage 265.00 RELIABLE SNOW REMOVE 12/15-16 345983 100501 9116.65353/24/2022 Other Contractual Services Cedar Grove Parking Garage 99.56 CINTAS MATS MOPS TOWELS #56138 345983 100501 9116.65353/24/2022 Other Contractual Services Cedar Grove Parking Garage 99.56 CINTAS MATS MOPS TOWELS #96193 345983 100501 9116.65353/24/2022 Other Contractual Services Cedar Grove Parking Garage 3/24/2022City of Eagan 16:49:19R55CKR2LOGIS102V 5Page -Council Check Register by GL Check Register w GL Date & Summary 3/25/20223/21/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225527 3/25/2022 152916 CORNERSTONE PARKING GROUP Continued... 18,168.82 PARKING MANAGEMENT FEB 2022 345983 100501 9116.65693/24/2022 Maintenance Contracts Cedar Grove Parking Garage 31,405.19 225528 3/25/2022 100042 CRAWFORD DOOR SALES COMPANY 1,140.00 GARAGE DOOR REPAIR 345705 45285 3313.65353/23/2022 Other Contractual Services Fire Buildings 1,140.00 225529 3/25/2022 100050 DAKOTA ELECTRIC 27.32 OLD TOWN HALL 345621 100749-1-FEB22 3304.64053/25/2022 Electricity Bldg/Facilities Maintenance 141.48 CARLSON LAKE SAN 345622 102339-9-FEB22 6239.64083/25/2022 Electricity-Lift Stations Lift Station Maintenanc/Repair 224.20 SOUTHERN HILLS TOWER 345623 103460-2-FEB22 6154.64093/25/2022 Electricity-Wells/Booster Stat South Plant Building 5,571.05 FIRE SAFETY CENTER 345624 108247-8-FEB22 3313.64053/25/2022 Electricity Fire Buildings 1,953.29 PUBLIC WORKS GARAGE 345625 110986-7-FEB22 3304.64053/25/2022 Electricity Bldg/Facilities Maintenance 274.32 YANKEE DOODLE WATER TANK RSVR 345626 112682-0-FEB22 6146.64093/25/2022 Electricity-Wells/Booster Stat North Plant Building 340.29 LONE OAK SAN 345627 112832-1-FEB22 6239.64083/25/2022 Electricity-Lift Stations Lift Station Maintenanc/Repair 347.87 WELL #1 345628 112885-9-FEB22 6146.64093/25/2022 Electricity-Wells/Booster Stat North Plant Building 147.99 CARLSON LAKE STORM 345629 122797-4-FEB22 6439.64083/25/2022 Electricity-Lift Stations Lift Station Maintenanc/Repair 184.49 WELL #2 345630 124865-7-FEB22 6146.64093/25/2022 Electricity-Wells/Booster Stat North Plant Building 1,829.40 MUNICIPAL CENTER 345631 127189-9-DWV22 3304.64053/25/2022 Electricity Bldg/Facilities Maintenance 39.93 BLACKHAWK COVE SAN 345632 127325-9-FEB22 6239.64083/25/2022 Electricity-Lift Stations Lift Station Maintenanc/Repair 627.55 RAHN PARK 345633 132778-2-FEB22 3106.64053/25/2022 Electricity Structure Care & Maintenance 101.72 LEXINGTON STORM STATION 345634 133789-8-FEB22 6439.64083/25/2022 Electricity-Lift Stations Lift Station Maintenanc/Repair 25.18 ZOO METER 345635 136873-7-FEB22 6239.64083/25/2022 Electricity-Lift Stations Lift Station Maintenanc/Repair 3,734.60 WELL #4/TREATMENT PLANT 345636 137781-1-FEB22 6146.64093/25/2022 Electricity-Wells/Booster Stat North Plant Building 848.93 LODGEPOLE CT SECURITY LITES 345637 138267-0-FEB22 3106.64053/25/2022 Electricity Structure Care & Maintenance 632.57 CLIFF BOOSTER STATION 345638 139958-3-FEB22 6154.64093/25/2022 Electricity-Wells/Booster Stat South Plant Building 591.36 LEXINGTON BOOSTER STATION 345639 143222-8-FEB22 6154.64093/25/2022 Electricity-Wells/Booster Stat South Plant Building 443.36 FIRE STATION 3 345640 146053-4-FEB22 3313.64053/25/2022 Electricity Fire Buildings 57.11 OAK CHASE STORM 345641 146920-4-FEB22 6439.64083/25/2022 Electricity-Lift Stations Lift Station Maintenanc/Repair 17.85 COVINGTON STORM 345642 149810-4-FEB22 6439.64083/25/2022 Electricity-Lift Stations Lift Station Maintenanc/Repair 5.00 CIVIL DEFENSE SIREN 345643 155062-3-FEB22 1106.64053/25/2022 Electricity Emergency preparedness 5.00 CIVIL DEFENSE SIREN 345644 155063-1-FEB22 1106.64053/25/2022 Electricity Emergency preparedness 5.00 CIVIL DEFENSE SIREN 345645 155064-9-FEB22 1106.64053/25/2022 Electricity Emergency preparedness 38.54 SAFARI RESERVOIR 345646 159673-3-FEB22 6154.64093/25/2022 Electricity-Wells/Booster Stat South Plant Building 90.35 HURLEY STORM 345647 159822-6-FEB22 6439.64083/25/2022 Electricity-Lift Stations Lift Station Maintenanc/Repair 66.91 SCHWANZ STORM 345648 160898-3-FEB22 6439.64083/25/2022 Electricity-Lift Stations Lift Station Maintenanc/Repair 39.18 LONE OAK/35 SIGNALS 345649 162414-7-FEB22 6301.64073/25/2022 Electricity-Signal Lights Street Lighting 46.86 OAK CLIFF STORM 345650 165267-6-FEB22 6439.64083/25/2022 Electricity-Lift Stations Lift Station Maintenanc/Repair 281.34 NORTHVIEW PARK 345651 167128-8-FEB22 3106.64053/25/2022 Electricity Structure Care & Maintenance 66.67 35E/CLIFF SIGNALS 345652 167845-7-FEB22 6301.64073/25/2022 Electricity-Signal Lights Street Lighting 3/24/2022City of Eagan 16:49:19R55CKR2LOGIS102V 6Page -Council Check Register by GL Check Register w GL Date & Summary 3/25/20223/21/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225529 3/25/2022 100050 DAKOTA ELECTRIC Continued... 66.42 35E/CLIFF SIGNALS 345653 167846-5-FEB22 6301.64073/25/2022 Electricity-Signal Lights Street Lighting 36.39 35E/PILOT KNOB SIGNALS 345654 167849-9-FEB22 6301.64073/25/2022 Electricity-Signal Lights Street Lighting 36.27 35E/PILOT KNOB SIGNALS 345655 167850-7-FEB22 6301.64073/25/2022 Electricity-Signal Lights Street Lighting 65.79 35E/YANKEE DOODLE SIGNALS 345656 167851-5-FEB22 6301.64073/25/2022 Electricity-Signal Lights Street Lighting 33.11 RAHN PARK 345657 169262-3-FEB22 3106.64053/25/2022 Electricity Structure Care & Maintenance 652.67 GOAT HILL PARK HOCKEY RINK 345658 170635-7-FEB22 3106.64053/25/2022 Electricity Structure Care & Maintenance 148.42 GOAT HILL PARK BASEBALL FIELD 345659 170636-5-FEB22 3106.64053/25/2022 Electricity Structure Care & Maintenance 439.82 BLUE CROSS PARK 345660 177546-9-FEB22 3106.64053/25/2022 Electricity Structure Care & Maintenance 50.02 BLACKHAWK/CLIFF SIGNALS 345661 187873-5-FEB22 6301.64073/25/2022 Electricity-Signal Lights Street Lighting 362.43 COUNTRY HOLLOW SAN 345662 193140-1-FEB22 6239.64083/25/2022 Electricity-Lift Stations Lift Station Maintenanc/Repair 475.45 COUNTRY HOLLOW STORM 345663 193575-8-FEB22 6439.64083/25/2022 Electricity-Lift Stations Lift Station Maintenanc/Repair 1,570.44 FIRE STATION 4 345664 195895-8-FEB22 3313.64053/25/2022 Electricity Fire Buildings 4,378.67 WELL #10 345665 196322-2-FEB22 6154.64093/25/2022 Electricity-Wells/Booster Stat South Plant Building 299.14 THOMAS LAKE STORM 345666 196919-5-FEB22 6439.64083/25/2022 Electricity-Lift Stations Lift Station Maintenanc/Repair 129.88 MURPHY SAN 345667 198484-8-FEB22 6239.64083/25/2022 Electricity-Lift Stations Lift Station Maintenanc/Repair 49.89 SIGNAL LIGHT TARGET 345668 198523-3-FEB22 6301.64073/25/2022 Electricity-Signal Lights Street Lighting 11,051.05 SOUTH TREATMENT PLANT 345669 201358-9-FEB22 6154.64093/25/2022 Electricity-Wells/Booster Stat South Plant Building 180.89 BLACKHAWK PAVILLION 345670 211088-0-FEB22 3106.64053/25/2022 Electricity Structure Care & Maintenance 15.96 WEST GROUP NORTH 345671 212539-1-FEB22 6239.64083/25/2022 Electricity-Lift Stations Lift Station Maintenanc/Repair 3,010.56 POLICE STATION 345672 217026-4-FEB22 3304.64053/25/2022 Electricity Bldg/Facilities Maintenance 4,675.02 CIVIC ICE ARENA 345673 220593-8-FEB22 6601.64053/25/2022 Electricity General/Administrative-Arena 53.17 DENMARK/TWN CNTR SIGNALS 345674 224458-0-FEB22 6301.64073/25/2022 Electricity-Signal Lights Street Lighting 5.00 CIVIL DEFENSE SIREN 345675 224623-9-FEB22 1106.64053/25/2022 Electricity Emergency preparedness 5.00 CIVIL DEFENSE SIREN 345676 224624-7-FEB22 1106.64053/25/2022 Electricity Emergency preparedness 5.00 CIVIL DEFENSE SIREN 345677 224625-4-FEB22 1106.64053/25/2022 Electricity Emergency preparedness 151.37 WELL #18 345678 224626-2-FEB22 6154.64093/25/2022 Electricity-Wells/Booster Stat South Plant Building 259.19 DEERWOOD RESERVOIR 345679 224893-8-FEB22 6154.64093/25/2022 Electricity-Wells/Booster Stat South Plant Building 180.08 YANKEE/WASHINGTON STREET LITES 345680 226048-7-FEB22 6301.64063/25/2022 Electricity-Street Lights Street Lighting 251.35 YANKEE/35E STREET LITES 345681 226049-5-FEB22 6301.64063/25/2022 Electricity-Street Lights Street Lighting 363.12 YANKEE/DENMARK STREET LITES 345682 226050-3-FEB22 6301.64063/25/2022 Electricity-Street Lights Street Lighting 319.35 YANKEE/PROMENADE STREET LITES 345683 226051-1-FEB22 6301.64063/25/2022 Electricity-Street Lights Street Lighting 202.42 NORTHWD/PROMENADE STREET LITES 345803 226052-9-FEB22 6301.64063/25/2022 Electricity-Street Lights Street Lighting 553.12 AQUATIC ADMIN BLDG 345804 256881-4-FEB22 6719.64053/25/2022 Electricity Building Maintenance 378.16 AQUATIC PARKING LOT LIGHT 345805 263297-4-FEB22 6719.64053/25/2022 Electricity Building Maintenance 179.93 AQUATIC MECH BLDG 345806 272182-7-FEB22 6719.64053/25/2022 Electricity Building Maintenance 166.94 AQUATIC CHANGE FACILITY 345807 272183-5-FEB22 6719.64053/25/2022 Electricity Building Maintenance 15.96 WEST GROUP SOUTH 345808 300763-0-FEB22 6239.64083/25/2022 Electricity-Lift Stations Lift Station Maintenanc/Repair 50.26 CLUBVIEW/LEXINGTON SIGNALS 345809 313124-0-FEB22 6301.64073/25/2022 Electricity-Signal Lights Street Lighting 54.94 LEX/N ARMSTRONG BLVD SISGNALS 345810 313127-3-FEB22 6301.64073/25/2022 Electricity-Signal Lights Street Lighting 3/24/2022City of Eagan 16:49:19R55CKR2LOGIS102V 7Page -Council Check Register by GL Check Register w GL Date & Summary 3/25/20223/21/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225529 3/25/2022 100050 DAKOTA ELECTRIC Continued... 980.00 GENERATOR 345811 326096-5-FEB22 3304.64053/25/2022 Electricity Bldg/Facilities Maintenance 223.61 THOMAS LAKE PARK 345812 348080-3-FEB22 3106.64053/25/2022 Electricity Structure Care & Maintenance 19.36 THRESHER PARK 345813 349188-3-FEB22 3106.64053/25/2022 Electricity Structure Care & Maintenance 29.83 DUCKWOOD/TOWN CNTR SIGNALS 345814 357166-1-FEB22 6301.64073/25/2022 Electricity-Signal Lights Street Lighting 192.32 1960 CLIFF LAKE RD AERATOR 345815 412466-5-FEB22 6520.64053/25/2022 Electricity Basin Mgmt-Aeration 16.08 DEERWOOD/35E SPDSIGN 345816 417173-2-FEB22 6301.64073/25/2022 Electricity-Signal Lights Street Lighting 35.76 THRESHER PARK BLDG 345817 427290-2-FEB22 3106.64053/25/2022 Electricity Structure Care & Maintenance 340.55 SHERMAN CT BRIDGE LITES 345818 440715-1-FEB22 6301.64063/25/2022 Electricity-Street Lights Street Lighting 15.96 1940 CLIFF LAKE RD 345819 452288-4-FEB22 2271.64053/25/2022 Electricity Boulevard/Ditch Mtn 66.54 RAHN/DIFFLEY RD #LIGHTS 345820 453294-1-FEB22 6301.64073/25/2022 Electricity-Signal Lights Street Lighting 15.96 4237 DANIEL DRIVE #SIGN 345821 456815-0-FEB22 6301.64073/25/2022 Electricity-Signal Lights Street Lighting 15.96 4266 DANIEL DRIVE #SIGN 345822 456817-6-FEB22 6301.64073/25/2022 Electricity-Signal Lights Street Lighting 6,716.78 CIVIC ICE ARENA 345823 463323-6-FEB22 6601.64053/25/2022 Electricity General/Administrative-Arena 135.92 FEDERAL DRIVE STREET LITES 345824 483732-4-FEB22 6301.64073/25/2022 Electricity-Signal Lights Street Lighting 41.82 DEERWOOD/PILOT KNOB SIGNALS 345825 509475-0-FEB22 6301.64073/25/2022 Electricity-Signal Lights Street Lighting 245.61 DE SWITCH/COMM BLDG 345826 529232-1-FEB22 6147.64083/25/2022 Electricity-Lift Stations North Plant Production 720.58 EAGAN SWITCH/COMM BLDG 345827 529233-9-FEB22 6147.64083/25/2022 Electricity-Lift Stations North Plant Production 305.16 CAMPUS GENERATOR/TRANSFORMER 345828 529234-7-FEB22 6147.64083/25/2022 Electricity-Lift Stations North Plant Production 383.72 DENMARK LIFT STATION 345829 532128-6-FEB22 6239.64083/25/2022 Electricity-Lift Stations Lift Station Maintenanc/Repair 398.36 WITHAM LANE LIFT STATION 345830 545622-3-FEB22 6239.64083/25/2022 Electricity-Lift Stations Lift Station Maintenanc/Repair 45.61 PROMENADE DR #SIGNALS 345831 549208-7-FEB22 6301.64073/25/2022 Electricity-Signal Lights Street Lighting 157.64 WELL #3 345832 555257-5-FEB22 6146.64093/25/2022 Electricity-Wells/Booster Stat North Plant Building 500.89 BRINE/SALT STORAGE 345833 555450-6-FEB22 3304.64053/25/2022 Electricity Bldg/Facilities Maintenance 351.00 UTILITY BUILDING 345834 555451-4-FEB22 6146.64053/25/2022 Electricity North Plant Building 49.14 BLACKHAWK PARK AERATOR 345835 557042-9-FEB22 6520.64053/25/2022 Electricity Basin Mgmt-Aeration 70.20 WIDGEON WAY 345836 571231-0-FEB22 6239.64083/25/2022 Electricity-Lift Stations Lift Station Maintenanc/Repair 398.98 CENTRAL MAINTENANCE FACILITY 345837 1001469-2-FEB22 3304.64053/25/2022 Electricity Bldg/Facilities Maintenance 114.87 3619 ASHBURY RD 345838 1001528-4-FEB22 6239.64083/25/2022 Electricity-Lift Stations Lift Station Maintenanc/Repair 197.62 BORCHERT LANE #LIGHTS 345839 1002491-2-FEB22 6301.64073/25/2022 Electricity-Signal Lights Street Lighting 16.59 CLIFF LAKE RD RRFB 345840 1002786-8-FEB22 6301.64063/25/2022 Electricity-Street Lights Street Lighting 64.15 TH 77/CO RD 32 SGNLS-2250 CLIF 345841 1002801-1-FEB22 6301.64073/25/2022 Electricity-Signal Lights Street Lighting 126.35 YANKEE STREET LITE CONTROLLERR 345842 1002973-3-FEB22 6301.64063/25/2022 Electricity-Street Lights Street Lighting 137.44 TRAPP FARM PARK 345843 1003514-9-FEB22 3106.64053/25/2022 Electricity Structure Care & Maintenance 108.93 APOLLO STORM 345844 1003721-6-FEB22 6439.64083/25/2022 Electricity-Lift Stations Lift Station Maintenanc/Repair 111.70 YANKEE STORM 345845 1006499-5-FEB22 6439.64083/25/2022 Electricity-Lift Stations Lift Station Maintenanc/Repair 195.32 BLACKHAWK PARK/LAKE AERATOR 345846 1007974-5-FEB22 6520.64053/25/2022 Electricity Basin Mgmt-Aeration 63,275.67 225530 3/25/2022 100447 DALCO 2,153.64 COVID-19 345706 3908246 3312.62233/23/2022 Building/Cleaning Supplies Emergency management 3/24/2022City of Eagan 16:49:19R55CKR2LOGIS102V 8Page -Council Check Register by GL Check Register w GL Date & Summary 3/25/20223/21/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225530 3/25/2022 100447 DALCO Continued... 2,153.64 225531 3/25/2022 142972 DOUGHERTY, MOLENDA, SOLFEST, HILLS 5,151.00 LEGAL 345925 204920-04768 0601.63113/25/2022 Legal General Legal Service 240.80 PROJ 1447 DEERWOOD DR 345926 204920-04768-1 8447.67163/25/2022 Project - Legal P1447 Deerwood Dr 51.60 LEGAL 345927 204936-44988 0601.63113/25/2022 Legal General Legal Service 120.40 ASSET WORKS JPA 345928 204941-45198 2440.62703/25/2022 Computer Software Equip Maint-General 326.80 LEGAL 345929 204944-45294 0601.63113/25/2022 Legal General Legal Service 235.80 AT&T YANKEE 4CLTE6C 345930 204923-36296 6008.6311 AAT&T3/25/2022 Legal Yankee Doodle Antenna Location 262.00 AT&T SAFARI 4C5C 345931 204924-36297 6005.6311 AAT&T3/25/2022 Legal Safari Antenna Location 419.20 VERIZON DEERWOOD C BAND 345932 204925-36949 6001.6311 AVERI3/25/2022 Legal Deerwood Antenna Location 707.40 VERIZON SOUTHERN LAKES C BAND 345933 204926-37003 6006.6311 AVERI3/25/2022 Legal South Lakes Tower Antenna Loca 314.40 VERIZON YANKEE C BAND 345934 204927-37751 6008.6311 AVERI3/25/2022 Legal Yankee Doodle Antenna Location 209.60 VERIZON SPERRY C BAND 345935 204928-38505 6007.6311 AVERI3/25/2022 Legal Sperry Antenna Location 655.00 CLEARWIRE LEXINGTON DECOM 345936 204929-42973 6003.6311 ASPRI3/25/2022 Legal Lexington Antenna Location 131.00 VIKINGS LAKES APARTMENTS 345937 204933-44776 9001.2245 J05563/25/2022 Escrow - Private Development F General Fund 104.80 T-MOBILE SAFARI GENERATOR 345938 204934-44826 6005.6311 ATMOB3/25/2022 Legal Safari Antenna Location 104.80 METRO STORAGE 345939 204930-43576 9001.2245 J05113/25/2022 Escrow - Private Development F General Fund 104.80 OAKVIEW CENTER 3RD 345940 204931-44124 9001.2245 J05323/25/2022 Escrow - Private Development F General Fund 366.80 RIVERS OF LIFE 345941 204932-44644 9001.2245 J05533/25/2022 Escrow - Private Development F General Fund 228.40 PROJ 1476 DIFFLEY STREET LIGHT 345942 204935-44908 8476.67163/25/2022 Project - Legal P1476 Diffley/Rahn street ligh 366.80 TESSERACT 4TH ADDITION 345943 204937-44994 9001.2245 J05643/25/2022 Escrow - Private Development F General Fund 393.00 ALLIANT VENTURES PARKSIDE 345944 204938-45092 9001.2245 J05673/25/2022 Escrow - Private Development F General Fund 366.80 KWIK TRIP STARKEYS 345945 204939-45093 9001.2245 J05663/25/2022 Escrow - Private Development F General Fund 340.60 TAILWIND TECHNOLOGIES 345946 204940-45162 9001.2245 J05703/25/2022 Escrow - Private Development F General Fund 131.00 STANLEY & WENCL 345947 204942-45271 9001.2245 J05713/25/2022 Escrow - Private Development F General Fund 131.00 SUITE LIVING SENIOR CARE 345948 204943-42572 9001.2245 J05723/25/2022 Escrow - Private Development F General Fund 288.80 LEGAL 345949 204921-10388 0601.63113/25/2022 Legal General Legal Service 1,566.00 LEGAL 345950 204922-12651 0601.63113/25/2022 Legal General Legal Service 13,318.60 225532 3/25/2022 160224 DUBAY, KELLY 150.00 WATER CONSERVATION REBATE PROG 345707 220314115048 9376.68603/23/2022 Contributions/Cost Sharing Pay Combined Utility Trunk Fund 150.00 225533 3/25/2022 100387 EAGAN GENERAL REPAIR 250.00 SOCCER GOAL REPAIR 345708 30060 3118.62343/23/2022 Field/Other Equipment Repair Athletic Field Mtn/Setup 250.00 225534 3/25/2022 150747 EAGAN KICK-START ROTARY CLUB 3/24/2022City of Eagan 16:49:19R55CKR2LOGIS102V 9Page -Council Check Register by GL Check Register w GL Date & Summary 3/25/20223/21/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225534 3/25/2022 150747 EAGAN KICK-START ROTARY CLUB Continued... 230.00 ROTARY DUES 345709 1014 3001.64763/23/2022 Conferences/Meetings/Training General/Admn-Recreation 230.00 225535 3/25/2022 101006 EMERGENCY AUTO TECHNOLOGIES 294.89 PD 345710 DL030922-21 3511.66803/23/2022 Mobile Equipment Equip Rev Fd-Dept 11 267.96 PD 345711 DL02152221A 3511.66803/23/2022 Mobile Equipment Equip Rev Fd-Dept 11 267.96 PD 345712 DL02152221 3511.66803/23/2022 Mobile Equipment Equip Rev Fd-Dept 11 830.81 225536 3/25/2022 100451 FASTENAL COMPANY 12.57 HARDWARE 345713 MNTC1268765 3127.62203/23/2022 Operating Supplies - General Equipment Maintenance/Repair 23.59 ANCHORS FOR PIPE HANGERS 345984 MNTC1268810 6146.62303/24/2022 Repair/Maintenance Supplies-Ge North Plant Building 48.97 HARDWARE FOR PROJECTS 345985 MNTC1268846 6146.62303/24/2022 Repair/Maintenance Supplies-Ge North Plant Building 85.13 225537 3/25/2022 141851 FERGUSON WATERWORKS 55.98 MOONSHINE SINK 345714 9159415 3106.62333/23/2022 Building Repair Supplies Structure Care & Maintenance 55.98 225538 3/25/2022 143971 FLEETPRIDE 1,217.73 STOCK PARTS 345715 94678226 9001.14153/23/2022 Inventory - Parts General Fund 2,506.81 EA1210 345716 93667511 9001.14153/23/2022 Inventory - Parts General Fund 3,724.54 225539 3/25/2022 160240 FOBBE CONTRACTING INC 1,100.00 HYDRANT GROOVING TO REPAIR BAR 345986 5183 6144.64323/24/2022 Utility System Repair-Labor Hydrant Maintenance/Repair 1,100.00 225540 3/25/2022 160245 FOKKEN, KYLE 1,000.00 CIP PUBLIC ART 345987 030222 2852.67623/24/2022 Special Features/Furnishings General Park Site Improvmts 1,000.00 225541 3/25/2022 143003 FORKLIFTS OF MINNESOTA INC. 120.00 KEVIN FORKLIFT TRAINING 345717 01E9026410 6601.64793/23/2022 Dues and Subscriptions General/Administrative-Arena 744.00 FORKLIFT FOR TURF INSTALL 345718 01R9020660 6602.64573/23/2022 Machinery & Equipment-Rental Equipment Repair & Maint. 864.00 225542 3/25/2022 111768 FRONTIER COMMUNICATIONS OF MN 57.61 BISCAYNE AVE SAN LIFT STATION 345719 02231244-S-2206 9-MAR22 6239.63523/23/2022 Telephone Circuits Lift Station Maintenanc/Repair 3/24/2022City of Eagan 16:49:19R55CKR2LOGIS102V 10Page -Council Check Register by GL Check Register w GL Date & Summary 3/25/20223/21/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225542 3/25/2022 111768 FRONTIER COMMUNICATIONS OF MN Continued... 57.61 225543 3/25/2022 100578 GENUINE PARTS COMPANY 501.47 STREET/MECHANICS 345720 14302615-022822 9001.14153/23/2022 Inventory - Parts General Fund 41.34 BLDG. MAIN 345720 14302615-022822 3313.62333/23/2022 Building Repair Supplies Fire Buildings 542.81 225544 3/25/2022 100465 GERTEN GREENHOUSES 1,620.00 BALLFIELD SUPPLIES 345721 156461/12 3118.62513/23/2022 Athletic Field Supplies Athletic Field Mtn/Setup 1,620.00 225545 3/25/2022 100990 GRAINGER 279.00 FILTERS FOR BUILDING 345722 9247082325 6603.62333/23/2022 Building Repair Supplies Building Repair & Maint. 616.51 SUPPLIES FOR ELECT LAB 345988 9244357100 6146.62603/24/2022 Utility System Parts/Supplies North Plant Building 44.10 ELECT RELAY FOR CONTROLS 345989 9242808120 6147.62603/24/2022 Utility System Parts/Supplies North Plant Production 939.61 225546 3/25/2022 100085 HARDWARE HANK 29.96 PD SUPPLIES 345723 2024145 1104.62203/23/2022 Operating Supplies - General Patrolling/Traffic 7.49 NTP CL2 345990 2024125 6147.62303/24/2022 Repair/Maintenance Supplies-Ge North Plant Production 37.45 225547 3/25/2022 152930 HARRIS MECHANICAL SERVICES LLC 614.68 PARTS FOR RESTROOM CONVERSION 345724 507030343 6603.62333/23/2022 Building Repair Supplies Building Repair & Maint. 1,554.00 LABOR FOR RESTROOM CONVERSION 345724 507030343 6603.65353/23/2022 Other Contractual Services Building Repair & Maint. 2,168.68 225548 3/25/2022 100267 HAYES ELECTRIC 36.47 RAHN LED LIGHTS 345725 4587 3109.62333/23/2022 Building Repair Supplies Lighting Maintenance 164.00 RAHN LED LIGHTS 345725 4587 3109.64273/23/2022 Building Operations/Repair-Lab Lighting Maintenance 326.00 R&R LED CONVERSION PARKS 345725 4587 3624.66203/23/2022 Buildings Facilities R&R Fd-Mtn Facility 526.47 225549 3/25/2022 100082 HEALTHPARTNERS 1,938.00 DENTAL ADMIN - APR 2022 345726 111421413 9594.61613/23/2022 Dental self-insurance admin fe Dental Self-insurance 1,938.00 225550 3/25/2022 113918 HILLYARD 6,611.64 GYM RE-FINISH CHEMICALS 345727 604667064 6827.65353/23/2022 Other Contractual Services Building Maintenance 6,611.64 3/24/2022City of Eagan 16:49:19R55CKR2LOGIS102V 11Page -Council Check Register by GL Check Register w GL Date & Summary 3/25/20223/21/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225550 3/25/2022 113918 HILLYARD Continued... 225551 3/25/2022 100297 HOLIDAY COMMERCIAL 210.00 SQUAD CAR WASHES 345728 1400-006-311-45 8-030822 1104.63543/23/2022 Car Washes Patrolling/Traffic 210.00 225552 3/25/2022 100627 HOME DEPOT CREDIT SERVICES 115.91 VEHICLE CLEANING MAINT 345951 9012031-021722 2244.62203/25/2022 Operating Supplies - General Street Equipment Repair/Mtn 9.97 LIGHT FOR FIRE TRUCK 1219 345952 4615696 9001.14153/25/2022 Inventory - Parts General Fund 8.94 VEHICLE MAINTENANCE 345953 7013258 2244.62203/25/2022 Operating Supplies - General Street Equipment Repair/Mtn 29.94 MAILBOX REPAIR 345954 1013776 2240.62563/25/2022 Snow Removal/Ice Control Suppl Street Plowing/Sanding 10.87 SIGN INSTALLATION 345954 1013776 2244.62573/25/2022 Signs & Striping Material Street Equipment Repair/Mtn 15.97 WORK GLOVES 345955 13855 2401.62403/25/2022 Small Tools Gen/Adm-Central Services 80.94 SHRINK WRAP 345956 8521505 2401.62413/25/2022 Shop Materials Gen/Adm-Central Services 21.97 SAW BLADE 345957 1011812 3103.62403/25/2022 Small Tools Site Amenity Maintenance 5.43 TRAPP FURNACE 345958 11949 3106.62333/25/2022 Building Repair Supplies Structure Care & Maintenance 99.00 IRRIGATION CUTTING TOOL 345959 44500 3113.62403/25/2022 Small Tools Non-Park Turf Maintenance 9.98 FURNACE FILTERS 345960 9012048 3106.62233/25/2022 Building/Cleaning Supplies Structure Care & Maintenance 5.20 HARDWARE 345961 9351174 3106.62203/25/2022 Operating Supplies - General Structure Care & Maintenance 29.84 DOOR DEADBOLT HOLZ 345962 7013261 3106.62333/25/2022 Building Repair Supplies Structure Care & Maintenance 34.40 RAHN PICKLEBALL FENCE 345963 5013453 3124.62203/25/2022 Operating Supplies - General Court Maintenance/Set-up 26.91 TORCH FUEL FOR HOCKEY NETTING 345964 5513698 3170.62203/25/2022 Operating Supplies - General General AdmIn-Parks 15.50 CMF FIRE EXTINGUISHER SIGNAGE 345965 5513699 3304.62333/25/2022 Building Repair Supplies Bldg/Facilities Maintenance 24.64 BENCH REPAPIRS 345966 4013518 3103.62523/25/2022 Parks & Play Area Supplies Site Amenity Maintenance 12.64 RAHN PICKLE BALL COURT SIGN 345967 4013584 3124.62573/25/2022 Signs & Striping Material Court Maintenance/Set-up 7.66 IRRIGATION CONTROLLER WIRE NUT 345968 4351223 3113.62343/25/2022 Field/Other Equipment Repair Non-Park Turf Maintenance 41.80 RECYCLING CAN SIGNS 345969 1013780 3103.62203/25/2022 Operating Supplies - General Site Amenity Maintenance 293.22 SKY HILL SHELVING 345970 1013785 3107.66203/25/2022 Buildings Building/Structure Constr 131.85 PICNIC TABLE REPAIRS 345971 1514233 3103.62523/25/2022 Parks & Play Area Supplies Site Amenity Maintenance 5.16 LIGHT TABLES 345972 610965 3057.62273/25/2022 Recreation Equipment/Supplies Preschool Programs 5.12 RECYCLE SIGNS 345973 9013958 3103.62573/25/2022 Signs & Striping Material Site Amenity Maintenance 152.28-SKY HILL SHELVING 345974 7193912 3107.62203/25/2022 Operating Supplies - General Building/Structure Constr 890.58 225553 3/25/2022 104674 INDELCO PLASTICS CORP. 322.92 CL2 FEED LINE 345991 INV314846 6147.62603/24/2022 Utility System Parts/Supplies North Plant Production 1,000.60 FL2 PARTS 345992 INV315357 6147.62603/24/2022 Utility System Parts/Supplies North Plant Production 1,323.52 225554 3/25/2022 160237 KENNEALY, COLLEEN 3/24/2022City of Eagan 16:49:19R55CKR2LOGIS102V 12Page -Council Check Register by GL Check Register w GL Date & Summary 3/25/20223/21/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225554 3/25/2022 160237 KENNEALY, COLLEEN Continued... 827.50 ESC 345729 031822 9001.2245 J05593/23/2022 Escrow - Private Development F General Fund 827.50 225555 3/25/2022 156909 KNOT WORLDWIDE INC, THE 2,010.00 THE KNOT-ECC ADVERTISING 345993 INVUSD591580796 6802.63573/24/2022 Advertising/Publication Banquet Room 2,010.00 225556 3/25/2022 149324 KONRAD MATERIAL SALES LLC 893.20 COLD MIX ASPHALLT 345730 1254814 2220.62553/23/2022 Street Repair Supplies Bituminous Surface Maint 893.20 225557 3/25/2022 100420 LEAGUE OF MINN CITIES INS TRUST 7,260.30 CLAIM #113968-NUNEZ 345731 7102 9591.63863/23/2022 Insurance Deductible Risk Management 2,295.00 CLAIM #111319-LEMAY TOWN ASSN 345732 7109 9591.63863/23/2022 Insurance Deductible Risk Management 9,555.30 225558 3/25/2022 137999 LIBERTY TIRE RECYCLING LLC 163.35 SCRAP TIRES 345733 2238191 2401.65393/23/2022 Waste Removal/Sanitation Servi Gen/Adm-Central Services 163.35 225559 3/25/2022 148130 LUBANOVIC, BILL 441.10 AERATION ELECTRICITY 345734 031722 6520.64053/23/2022 Electricity Basin Mgmt-Aeration 441.10 225560 3/25/2022 145890 MANSFIELD OIL COMPANY 2,031.75 GENERATOR FUEL 345735 23082485 3304.62433/23/2022 Heating Oil/Propane/Other Fuel Bldg/Facilities Maintenance 2,031.75 225561 3/25/2022 139121 MARCO INC. 4,877.77 COPIERS/PRINTERS 345736 31259817 0301.65693/23/2022 Maintenance Contracts IT-Gen & Admn 80.08 COPIERS/PRINTERS 345736 31259817 6501.65693/23/2022 Maintenance Contracts G/A - Water Quality 535.95 COPIERS/PRINTERS 345736 31259817 6101.65693/23/2022 Maintenance Contracts Water -Administration 84.40 COPIERS/PRINTERS 345736 31259817 6601.65693/23/2022 Maintenance Contracts General/Administrative-Arena 582.15 COPIERS/PRINTERS 345736 31259817 6801.65693/23/2022 Maintenance Contracts General & Administrative 6,160.35 225562 3/25/2022 155104 MARSLAND, KATE 73.92 CONT. ED TRAINER 345737 030722 6807.64773/23/2022 Local Meeting Expenses Fitness Center 73.92 3/24/2022City of Eagan 16:49:19R55CKR2LOGIS102V 13Page -Council Check Register by GL Check Register w GL Date & Summary 3/25/20223/21/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225563 3/25/2022 147901 MASTER ELECTRIC CO INC Continued... 1,200.00 ARC FLASH TRAINING 345994 SD39283 6203.64763/24/2022 Conferences/Meetings/Training Training & Education 1,200.00 225564 3/25/2022 160236 MEISTER, KELLEY 21.06 CPR TRAINING 345738 102521 3001.62223/23/2022 Medical/Rescue/Safety Supplies General/Admn-Recreation 21.06 225565 3/25/2022 100571 MENARDS-APPLE VALLEY 167.93 MOWER TRAILERING STRAPS 345739 32425 3127.62313/23/2022 Mobile Equipment Repair Parts Equipment Maintenance/Repair 27.67 RECYCLE SIGNS 345740 32428 3103.62573/23/2022 Signs & Striping Material Site Amenity Maintenance 30.26 IRRIGATION CONTROLLER 345741 32295 3117.62203/23/2022 Operating Supplies - General Irrigation System Mtn/Install 225.86 225566 3/25/2022 151095 MENARDS-BURNSVILLE 402.39 CIP NORTHVIEW MAINTBLDG 345742 72649 2818.67563/23/2022 Building & Structures Northview Athletic Fields 20,666.26 CIP NORTHVIEW MAINTBLDG 345743 72596 2818.67563/23/2022 Building & Structures Northview Athletic Fields 21,068.65 225567 3/25/2022 100710 METRO COUNCIL ENVIRONMENTAL SVCS 1,985.88 PROD WASTE DISCHARGE FEE 345744 0001137538 6147.64803/23/2022 Licenses, Permits and Taxes North Plant Production 1,985.88 225568 3/25/2022 102753 MINNCOR INDUSTRIES 60.00 D MILLER BUSINESS CARDS 345745 SOI-102835 0201.62103/23/2022 Office Supplies General & Admn-Admn 55.00 J MEINDERS BUSINESS CARDS 345745 SOI-102835 0301.62103/23/2022 Office Supplies IT-Gen & Admn 65.00 M JOHNSON BUSINESS CARDS 345745 SOI-102835 0820.62103/23/2022 Office Supplies General/Admn-Housing 180.00 225569 3/25/2022 160238 MINNEAPOLIS/ST PAUL PLUMBING HEATING AIR 59.00 PLUMBING PERMIT 345995 175179 0801.40873/24/2022 Plumbing General & Admn-Protective Insp 1.00 PLUMBING PERMIT REFUND 345995 175179 9001.21953/24/2022 Due to State - Permit Surcharg General Fund 60.00 225570 3/25/2022 121807 MN CLAY COMPANY USA 977.40 PROGRAM SUPPLIES 345746 127028 3081.62273/23/2022 Recreation Equipment/Supplies Arts & Humanities Council 41.90 PROGRAM SUPPLIES 345747 127175 3081.62273/23/2022 Recreation Equipment/Supplies Arts & Humanities Council 1,019.30 225571 3/25/2022 102468 MN DEPT OF HEALTH 23.00 LICENSE RENEWAL-TUIONE 345748 2022-TUIONE 6101.64803/23/2022 Licenses, Permits and Taxes Water -Administration 3/24/2022City of Eagan 16:49:19R55CKR2LOGIS102V 14Page -Council Check Register by GL Check Register w GL Date & Summary 3/25/20223/21/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225571 3/25/2022 102468 MN DEPT OF HEALTH Continued... 23.00 225572 3/25/2022 120087 MN ENERGY RESOURCES CORP 362.83 CASCADE BAY 345749 0506263442-0000 1-MAR22 6715.64103/23/2022 Natural Gas Service Cascade Utilities 18.00 CASCADE BAY 345750 0506263442-0000 2-MAR22 6715.64103/23/2022 Natural Gas Service Cascade Utilities 3,252.99 CIVIC ICE ARENA 345751 0504859971-0000 1-MAR22 6601.64103/23/2022 Natural Gas Service General/Administrative-Arena 8,920.51 CITY HALL 345752 0507679172-0000 1-MAR22 3304.64103/23/2022 Natural Gas Service Bldg/Facilities Maintenance 2,047.40 FIRE STATION 1 345753 0502896570-0000 4-MAR22 3313.64103/23/2022 Natural Gas Service Fire Buildings 201.50 SKYHILL PARK 345754 0505890818-0000 1-MAR22 3106.64103/23/2022 Natural Gas Service Structure Care & Maintenance 1,250.49 FIRE STATION 4 345755 0502992371-0000 1-MAR22 3313.64103/23/2022 Natural Gas Service Fire Buildings 143.24 GOAT HILL PARK 345756 0502896570-0000 1-MAR22 3106.64103/23/2022 Natural Gas Service Structure Care & Maintenance 3,648.98 PUBLIC WORKS GARAGE 345757 0505182087-0000 1-MAR22 3304.64103/23/2022 Natural Gas Service Bldg/Facilities Maintenance 132.80 MOONSHINE 345758 0506119075-0000 1-MAR22 3106.64103/23/2022 Natural Gas Service Structure Care & Maintenance 94.75 TIMBERLINE PUMPHOUSE 345759 0502341685-0000 1-MAR22 6146.64103/23/2022 Natural Gas Service North Plant Building 160.68 QUARRY PARK 345760 0507516709-0000 1-MAR22 3106.64103/23/2022 Natural Gas Service Structure Care & Maintenance 1,537.76 VEHICLE WASH 345761 0505460873-0000 4-MAR22 3304.64103/23/2022 Natural Gas Service Bldg/Facilities Maintenance 9.50 CENTRAL PARK PAVILLION 345762 0506640339-0000 1-MAR22 3106.64103/23/2022 Natural Gas Service Structure Care & Maintenance 1,054.38 HEATED VEHICLE STORAGE 345763 0502896570-0000 8-MAR22 3304.64103/23/2022 Natural Gas Service Bldg/Facilities Maintenance 749.60 EAGAN OUTLETS PKWY 345764 0507382197-0000 1-MAR22 9116.64103/23/2022 Natural Gas Service Cedar Grove Parking Garage 733.16 EAGAN OUTLETS COMMONS 345765 0504332209-0000 1-MAR22 9116.64103/23/2022 Natural Gas Service Cedar Grove Parking Garage 24,318.57 225573 3/25/2022 117900 MN GLOVE, INC. 3/24/2022City of Eagan 16:49:19R55CKR2LOGIS102V 15Page -Council Check Register by GL Check Register w GL Date & Summary 3/25/20223/21/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225573 3/25/2022 117900 MN GLOVE, INC.Continued... 71.98 CLOTHING ALLOWANCE - MURFF 345766 334781 6201.21153/23/2022 Clothing Allowance San Sewer-Administration 217.90 CLOTHING ALLOWANCE - GUNTER 345767 334782 6101.21153/23/2022 Clothing Allowance Water -Administration 289.88 225574 3/25/2022 107130 MN POLLUTION CONTROL AGENCY 23.00 LICENSE RENEWAL-S MURFF 345768 2022-2025 6201.64803/23/2022 Licenses, Permits and Taxes San Sewer-Administration 23.00 225575 3/25/2022 160225 MPX GROUP, THE 283.07 REFERENCE MATERIALS 345769 167136 1104.62153/23/2022 Reference Materials Patrolling/Traffic 283.07 225576 3/25/2022 100145 MRPA 125.00 SEAS REC JOB POSTINGS 345770 10396 1001.63583/23/2022 Employment Advertising General/Admn-Human Resources 125.00 225577 3/25/2022 100146 MTI DISTR CO 319.98 IRIGATION 345771 1336747-00 3117.62403/23/2022 Small Tools Irrigation System Mtn/Install 319.98 225578 3/25/2022 100149 NORTHERN TOOL 129.44 SIGN TRAILER INSTALL PARTS 345772 0034024452 2244.62313/23/2022 Mobile Equipment Repair Parts Street Equipment Repair/Mtn 2.99 SPARE QUICK LINK 345773 0031316046 3127.62203/23/2022 Operating Supplies - General Equipment Maintenance/Repair 132.43 225579 3/25/2022 157410 NORTHFIELD SOLAR LLC 7,985.55 ECC ELECTRICITY-FEB 2022 345774 2203-6992C 6824.64053/23/2022 Electricity Utilities 7,985.55 225580 3/25/2022 160048 PERRINE, LESLIE 19.95 MILEAGE 2/7/22-3/7/22 345775 030722 3081.65503/23/2022 Transportation Services Arts & Humanities Council 19.95 225581 3/25/2022 122946 PLUTA, LAWRENCE J. 56.97 CLOTHING ALLOWANCE 345776 031522 3170.21153/23/2022 Clothing Allowance General AdmIn-Parks 56.97 225582 3/25/2022 144472 PRECISE MRM LLC 620.00 AVL 345777 200-1036007 0301.65693/23/2022 Maintenance Contracts IT-Gen & Admn 620.00 3/24/2022City of Eagan 16:49:19R55CKR2LOGIS102V 16Page -Council Check Register by GL Check Register w GL Date & Summary 3/25/20223/21/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225582 3/25/2022 144472 PRECISE MRM LLC Continued... 225583 3/25/2022 160222 RAIN FOR RENT 1,643.80 ICE REMOVAL DUMSTER RENTAL 345778 1713818 6604.65353/23/2022 Other Contractual Services Ice Maintenance 1,643.80 225584 3/25/2022 143557 RANDSTAD (R) 941.70 ADMIN ASSIST 3/6-3/12/2022 345779 R30798708 9699.65613/23/2022 Temporary Help-Labor/Clerical DCDTF state grant 941.70 225585 3/25/2022 141789 RED WING SHOE STORE 278.38 CLOTHING ALLOW BILL HOIUM 345780 724-1-96682 2201.21153/23/2022 Clothing Allowance Gen/Adm-Streets 278.38 225586 3/25/2022 100728 RENT N SAVE 455.00 PORTABLE TOILETS 345781 67912 3111.65393/23/2022 Waste Removal/Sanitation Servi Refuse/Waste Control 455.00 225587 3/25/2022 102772 SECURITY CONTROL SYSTEMS, INC. 60.00 MONITORING FEES 345782 515792022 6716.64273/23/2022 Building Operations/Repair-Lab General Administration 60.00 225588 3/25/2022 100187 SEH 2,800.00 TELECOM 345783 422465 6001.6310 AVERI3/23/2022 Professional Services-General Deerwood Antenna Location 6,100.00 TELECOM 345784 422461 6006.6310 ATMOB3/23/2022 Professional Services-General South Lakes Tower Antenna Loca 2,300.00 TELECOM 345785 422463 6005.6310 ATMOB3/23/2022 Professional Services-General Safari Antenna Location 6,100.00 TELECOM 345786 422462 6003.6310 AVERI3/23/2022 Professional Services-General Lexington Antenna Location 2,800.00 TELECOM 345787 422466 6008.6310 AAT&T3/23/2022 Professional Services-General Yankee Doodle Antenna Location 6,100.00 TELECOM 345788 422464 6005.6310 AVERI3/23/2022 Professional Services-General Safari Antenna Location 26,200.00 225589 3/25/2022 151416 SMART DELIVERY SERVICE INC 206.40 SMART, INTEROFFICE MAIL 345789 79400 0401.65353/23/2022 Other Contractual Services General & Admn-City Clerk 206.40 225590 3/25/2022 102392 SPARTAN PROMOTIONAL GROUP, INC. 1,210.06 SEAS STAFF SUNGLASSES 345790 583404 1001.63583/23/2022 Employment Advertising General/Admn-Human Resources 371.11 SPARTAN - LEAGUE CHAMP SHIRTS 345791 600271 3041.62273/23/2022 Recreation Equipment/Supplies Adult Volleyball 1,581.17 225591 3/25/2022 114471 SPRINT 3/24/2022City of Eagan 16:49:19R55CKR2LOGIS102V 17Page -Council Check Register by GL Check Register w GL Date & Summary 3/25/20223/21/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225591 3/25/2022 114471 SPRINT Continued... 42.24 POLICE STREET POST 345792 204988812-172 1104.63493/23/2022 Teleprocessing Equipment Patrolling/Traffic 42.24 225592 3/25/2022 100854 ST PAUL STAMP WORKS, INC. 1,009.11 METER MAINTENANCE REPAIR 345996 IV00526412 6163.62603/24/2022 Utility System Parts/Supplies Meter Maintenance/Repair 1,009.11 225593 3/25/2022 160235 STANDARD HEATING & AIR CONDITIONING 59.00 MECHANICAL PERMIT REFUND 345799 173504 0801.40883/23/2022 Mechanical (Heating/Ventilatio General & Admn-Protective Insp 59.00 225594 3/25/2022 108989 TECH SALES CO. 5,250.00 ISCO CALIBRATIONS 345997 325837 6244.65353/24/2022 Other Contractual Services Sewer System Meterng/Monitorng 5,250.00 225595 3/25/2022 148858 TOP NOTCH 420.00 DRAIN CLEANING 345793 2200590 3313.65353/23/2022 Other Contractual Services Fire Buildings 420.00 225596 3/25/2022 160219 TRAFFIC LOGIX CORPORATION 2,909.00 DRIVER FEEDBACK SPEED LIMIT 345794 SIN26306 6301.66703/23/2022 Other Equipment Street Lighting 5,968.00 DRIVER FEEDBACK SPEED LIMIT 345795 SIN14734 6301.66703/23/2022 Other Equipment Street Lighting 8,877.00 225597 3/25/2022 155501 TUIONE, TODD 188.44 CLOTHING ALLOWANCE - TUIONE 345800 031522 6101.21153/23/2022 Clothing Allowance Water -Administration 188.44 225598 3/25/2022 144559 TWITO, RANDY 441.10 AERATION ELECTRICITY 345801 031722 6520.64053/23/2022 Electricity Basin Mgmt-Aeration 441.10 225599 3/25/2022 120163 ULINE INC. 964.00 SUPPLIES FOR ELECT LAB 345998 144000118 6146.62333/24/2022 Building Repair Supplies North Plant Building 964.00 225600 3/25/2022 149762 VERTIV SERVICES INC. 3,456.00 UPS MAINTENANCE 345796 13077583 0301.65693/23/2022 Maintenance Contracts IT-Gen & Admn 3,456.00 3/24/2022City of Eagan 16:49:19R55CKR2LOGIS102V 18Page -Council Check Register by GL Check Register w GL Date & Summary 3/25/20223/21/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 225601 3/25/2022 100237 VIKING ELECTRIC Continued... 239.94 POWER WIRE NTP 345999 S005601811.001 6147.62603/24/2022 Utility System Parts/Supplies North Plant Production 301.85 16GA WIRE AND SUPPLIES NTP 346000 S005603015.001 6147.62603/24/2022 Utility System Parts/Supplies North Plant Production 65.46 WIRE FOR CL2 SYSTEM 346001 S005603015.002 6147.62603/24/2022 Utility System Parts/Supplies North Plant Production 26.18 JUNCTION BOXES FOR CL2 CONTROL 346002 S005605967.001 6147.62303/24/2022 Repair/Maintenance Supplies-Ge North Plant Production 633.43 225602 3/25/2022 157076 WALCOTT SOLAR LLC 307.43 BAND SHELL-FEB 2022 345797 2203-6993E 3106.64053/23/2022 Electricity Structure Care & Maintenance 142.27 CENTRAL PARK PUMP STATION 2/22 345797 2203-6993E 3186.64053/23/2022 Electricity Recreation Program Support 7,132.46 ECC ELECTRICITY-FEB 2022 345797 2203-6993E 6824.64053/23/2022 Electricity Utilities 7,582.16 225603 3/25/2022 156857 WARSAW SOLAR LLC 2,370.60 ECC ELECTRICITY-FEB 2022 345798 2203-6994A 6824.64053/23/2022 Electricity Utilities 2,370.60 225604 3/25/2022 160242 WOLF RIVER ELECTRIC 339.25 BUILDING PERMIT BASE FEE 346003 EA173462 0801.40853/24/2022 Building General & Admn-Protective Insp 110.25 BUILDING PERMIT REFUND 346003 EA173462 0720.42223/24/2022 Plan Check Fees General Admin-Planning & Zonin 449.50 225605 3/25/2022 100247 ZIEGLER INC 55.07 WO 2022-288 345802 IN000458252 9001.14153/23/2022 Inventory - Parts General Fund 55.07 20225612 3/25/2022 147907 SELECT ACCOUNT 6,348.29 FLEX REIMBURSEMENT 345975 032222 9592.22153/25/2022 Flex Plan Withholding Payable Benefit Accrual 6,348.29 20225703 3/25/2022 147907 SELECT ACCOUNT 1,255.50 MONTHLY FEES 345976 032322 1001.65363/25/2022 Flex Plan Administration Fee General/Admn-Human Resources 1,255.50 20226002 3/25/2022 100901 MN DEPT OF REVENUE 2,126.00 SALES TAX - FEB 2022 345977 SALES TAX - FEB 2022 9001.22703/25/2022 Sales Tax Payable General Fund 78.00 TRANSIT TAX - FEB 2022 345977 SALES TAX - FEB 2022 9001.22713/25/2022 Transit Imprv Tax General Fund 2,310.00 SALES TAX - FEB 2022 345977 SALES TAX - FEB 2022 9220.22703/25/2022 Sales Tax Payable Public Utilities 3/24/2022City of Eagan 16:49:19R55CKR2LOGIS102V 19Page -Council Check Register by GL Check Register w GL Date & Summary 3/25/20223/21/2022 -- Inv No Account No Account Description Business UnitDoc NoCheck #PO #SubledgerSupplier / ExplanationDateAmount 20226002 3/25/2022 100901 MN DEPT OF REVENUE Continued... 83.00 TRANSIT TAX - FEB 2022 345977 SALES TAX - FEB 2022 9220.22713/25/2022 Transit Imprv Tax Public Utilities 1,171.00 SALES TAX - FEB 2022 345977 SALES TAX - FEB 2022 9221.22703/25/2022 Sales Tax Payable Civic Arena 34.00 TRANSIT TAX - FEB 2022 345977 SALES TAX - FEB 2022 9221.22713/25/2022 Transit Imprv Tax Civic Arena 448.00 SALES TAX - FEB 2022 345977 SALES TAX - FEB 2022 9222.22703/25/2022 Sales Tax Payable Cascade Bay 16.00 TRANSIT TAX - FEB 2022 345977 SALES TAX - FEB 2022 9222.22713/25/2022 Transit Imprv Tax Cascade Bay 5,153.00 SALES TAX - FEB 2022 345977 SALES TAX - FEB 2022 9223.22703/25/2022 Sales Tax Payable Central Park/Community Center 184.00 TRANSIT TAX - FEB 2022 345977 SALES TAX - FEB 2022 9223.22713/25/2022 Transit Imprv Tax Central Park/Community Center 11,603.00 20227002 3/25/2022 100901 MN DEPT OF REVENUE 905.05 FUEL TAX (CENT SV) FEB 2022 345978 FUEL TAX - FEB 2022 2244.62353/25/2022 Fuel, Lubricants, Additives Street Equipment Repair/Mtn 40.34 FUEL TAX (EQUIP) FEB 2022 345978 FUEL TAX - FEB 2022 3127.62353/25/2022 Fuel, Lubricants, Additives Equipment Maintenance/Repair 4.23 FUEL TAX (EQUIP) FEB 2022 345978 FUEL TAX - FEB 2022 3128.62353/25/2022 Fuel, Lubricants, Additives Vehicle Maintenance 28.50 FUEL TAX (SEWER) FEB 2022 345978 FUEL TAX - FEB 2022 6232.62353/25/2022 Fuel, Lubricants, Additives Equipment Maintenance/Repair 978.12 20228513 3/25/2022 151185 HEALTHPARTNERS INC 5,194.52 DENTAL CLAIMS REIMBURSEMENT 345979 032122 9594.61583/25/2022 Dental Insurance Dental Self-insurance 5,194.52 367,613.21 Grand Total Payment Instrument Totals Checks 367,613.21 Total Payments 367,613.21 3/24/2022City of Eagan 16:49:24R55CKS2LOGIS100 1Page -Council Check SummaryNote: Payment amount may not reflect the actual amount due to data sequencing and/or data selection. 3/25/20223/21/2022 - Company Amount 104,673.5709001GENERAL FUND 32,887.9509116CEDAR GROVE PARKING GARAGE 125,951.4609220PUBLIC UTILITIES 21,188.6009221CIVIC ARENA 2,672.9609222CASCADE BAY 32,416.2009223CENTRAL PARK /COMMUNITY CENTER 22,068.6509328PARK SYS DEV AND R&R 830.8109335EQUIPMENT REVOLVING 326.0009336GENERAL FACILITIES RENEW & REP 469.2009372REVOLVING SAF-CONSTRUCTION 150.0009376COMBINED UTILITY TRUNK FUND 9,555.3009591RISK MANAGEMENT 6,348.2909592BENEFIT ACCRUAL 7,132.5209594Dental Self-insurance 941.7009695DAK CO DRUG TASK FORCE Report Totals 367,613.21 Agenda Information Memo April 5, 2022 Eagan City Council Meeting CONSENT AGENDA D.Approve Contracts Action To Be Considered: To approve the ordinary and customary contracts listed below. Facts: ➢The contracts listed below are in order for Council approval. Following approval, the contracts will be electronically executed by the Mayor and City Clerk. Contracts to be approved: Vendor Service Agreement with LuLu Event Rentals for Farm to Table Event Vendor Service Agreement with James Dahl for Volunteer Appreciation Dinner Vendor Service Agreement with Marv Gohman for Holz Farm Spring Festival Sponsorship Agreement with River Valley Church Sponsorship Agreement with Viverant Agreement for July 4th Outdoor Fireworks Display Agreement for EBT & Market Bucks Initiative with Hunger Solutions Services Agreement with Ellie Mental Health Clinic to provide services to Law Enforcement and First Responders Service Agreement with Wilderness Inquiry for Eagan LakeFest Event Termination of Caterer Agreement with Kowalski's Catering for Services at the ECC Attachments: (0) The contracts are available from the City Clerk’s Office. Agenda Information Memo April 5, 2022, Eagan City Council Meeting CONSENT AGENDA E. Approve Fiber Optic Use Agreements with Velocity Telephone, Inc. Action To Be Considered: E. Approve Fiber Optic Use Agreements with Velocity Telephone, Inc. Facts: On June 4th, 2019, the City Council voted to change the operational service model of AccessEagan. AccessEagan will no longer be considered an enterprise operation. Rather, AccessEagan will be a City asset. Existing contracts will continue to be honored, supported and renewed until the contractual end date, unless alternatives are agreed by all parties. The City will consider dark fiber and conduit leases that do not impact City operations. The City has put together an agreement with Velocity Telephone, Inc. to transition existing lit fiber circuits to dark fiber. Velocity Telephone, Inc. will essentially lease dark fiber, which will allow the City to remove its electronics and reduce expenses incurred by the City. There are two separate agreements the City is proposing for approval. Velocity currently has two customers, Cedar Flats Apartments and an existing Rosemount development. Each fiber route is independent of the other and therefore the agreements include the separate paths. Attachments (2): CE-1 Fiber Optic Use Agreement – Cedar Flats.pdf CE-2 Fiber Optic Use Agreement – Rosemount.pdf FIBER OPTIC INDEFEASIBLE RIGHT TO USE THIS FIBER OPTIC INDEFEASIBLE RIGHT TO USE together with any attached exhibits (collectively the “Agreement”) made and entered into by and between the City of Eagan, a Minnesota municipal corporation (“IRU Grantor” or “the City”), and Velocity Telephone, Incorporated, a Minnesota corporation (“IRU Grantee” or “Velocity”). The IRU Grantor and IRU Grantee may be referred to herein individually as a “Party” or collectively as the “Parties.” BACKGROUND A. Velocity desires to lease Fibers from the City as described in this Agreement; and B. The City agrees to grant to Velocity the right to use specific Fibers within certain Fiber Optic Cable segments on the terms and conditions set forth below. DEFINITIONS The following terms are used in this IRU: A. “Effective Date” is the date upon which all Parties have executed this Agreement. B. “Fiber” means a glass strand or strands which is/are used to transmit a communication signal along the glass strand in the form of pulses of light. C. “Fiber Optic Cable” or “Cable” means a collection of fibers with a protective outer covering. D. “IRU Cable” means a Cable containing one or more Fibers, constructed and owned by the City in which the IRU Grantee has an IRU pursuant to the terms of this Agreement. E. “IRU Fibers” means the specific City owned Fiber described further herein, an IRU for which is granted to the IRU Grantee in the IRU Cable. F. “Indefeasible Right of Use” or “IRU” means an indefeasible right to use the IRU Fibers, provided, however, that granting of such IRU does not convey legal title to the IRU Fibers. G. “Optical Splice Point” means a point where the IRU Grantee’s Cable is connected to the City’s Cable within a splice enclosure. H. “Relocation” means any physical movement of fiber optic cable or conduit required due to reconstruction, modification, change in grade, expansion or relocation of a County road or highway, or a city street. I. “Right of Way” means the real property, including all fee simple, easements, access rights, rights of use and other interests devoted to road or highway purposes. 2 In consideration of their mutual promises, the parties expressly agree as follows: ARTICLE I LICENSES Section 1.1 Velocity desires to obtain an IRU in the IRU Fibers further described in Exhibit B to this Agreement, which is incorporated into this IRU by reference. In consideration of the promises by Velocity in this Agreement, the City grants an IRU to Velocity in the IRU Cable identified in Exhibit A hereto. The City shall deliver to Velocity the right to use the IRU Fibers, including, but not limited to, handholes, splice enclosures, and related equipment but excluding any electronic or optronic equipment at termination points. Prior to use, Velocity shall coordinate with City the use of any handholes and splice enclosures required for the IRU Fibers, as well as coordinate when splicing will be performed. Velocity shall be entitled to use the IRU Fibers for any lawful purposes subject to (i) agreeing to be bound by all laws, regulations and any requirements of the City regarding access to City rights of way, and (ii) otherwise complying with the terms and conditions of this IRU. Section 1.2 Subject to the terms and conditions of this Agreement, City hereby grants to Velocity a license to access and use the IRU Fibers within the Fiber Optic Cable segments described below during the term of this Agreement. The specific strands subject to this IRU segment are identified in Exhibit B. Section 1.3 The IRU Fibers are being leased to Velocity “as is.” If there is any equipment needed (e.g. splice cases, handholes, etc.) or any fiber splices needed to interconnect fiber cables, Velocity shall be responsible for coordinating its work with the City and shall pay any and all costs and fees associated with connecting the IRU Fibers to Velocity’s fibers. Section 1.4 Notwithstanding anything contained to the contrary in this Agreement, the Parties acknowledge and agree that nothing contained in this Agreement shall operate to limit, interfere with, or otherwise adversely affect each Party’s right to manage, control, construct, relocate, maintain, replace and expand their fiber optic network equipment and infr astructure that either may deem necessary or desirable in its sole discretion, subject only to the IRU and Velocity’s license to the IRU Fibers. ARTICLE II EFFECTIVE DATE AND TERM Velocity shall be entitled to use the IRU Fibers granted by the City upon the Effective Date. The term of this Agreement shall be for a monthly auto renewal unless terminated in writing by the Parties by 60 days prior notice, or one of the events set forth in Article 11, Section 11.2 of this Agreement occurs, whichever is first. 3 ARTICLE III LICENSE FEES Velocity shall be charged a monthly fee for use of IRU Fibers of Seventy-five Dollars and no/100 Dollars ($75.00) per strand mile per month for a total of Five Hundred Sixty Four Dollars and 75/100 Dollars ($564.75) due each month, which shall be payable in advance on or before the 1st of each month. ARTICLE IV MAINTENANCE AND REPAIR The City has already installed the Cable and all equipment necessary to connect Velocity’s Cable to its fiber optic network. The City shall be fully responsible for maintaining and repairing the Cable spliced into the IRU Fibers that connects the Cable to Velocity’s fiber optic network and associated equipment. ARTICLE V SPLICING Velocity shall be responsible for the cost of the initial splicing of Velocity’s Fibers at any Optical Splice Points and any additional splicing equipment that it requires to connect fibers to its optical fiber network. Velocity must obtain the City’s written consent prior to splicing any City owned Cable. ARTICLE VI REPRESENTATIONS AND WARRANTIES Section 6.1 Velocity warrants that its use of the IRU Fibers shall comply with all applicable governmental codes, ordinances, laws, rules, regulations and/or restrictions. Section 6.2 The City represents and warrants that it has the right to grant this IRU in the IRU Fibers. Section 6.3 Velocity’s sole and exclusive remedy and the City’s sole and exclusive maximum liability under this Agreement for failure of the IRU Fibers shall be, at the sole option of the City, to repair or replace any defective portion of the IRU Fibers, provided that the City is promptly notified in writing upon discovery by Velocity that any portion of the IRU Fibers has failed to conform with the terms of this IRU, such writing to include an explanation of alleged failures. Section 6.4 Neither Party’s warranties extend to defects caused by acts of God, accident, fire or other hazard, or by any misuse, neglect, alterations, storage, attempts to repair, or use of other supplies not meeting specifications. 4 THE FOREGOING WARRANTIES AND REMEDIES CONSTITUTE THE ONLY WARRANTIES WITH RESPECT TO THE IRU FIBERS. SUCH WARRANTIES ARE IN LIEU OF ALL OTHER WARRANTIES, WRITTEN OR ORAL, STATUTORY, EXPRESS OR IMPLIED, INCLUDING WITHOUT LIMITATION, ANY WARRANTY OF MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE. NEITHER PARTY SHALL IN ANY EVENT BE LIABLE FOR ANY INCIDENTAL, SPECIAL, OR CONSEQUENTIAL DAMAGES OF ANY NATURE WHATSOEVER FOR ANY REASON. ARTICLE VII LIABILITY; INDEMNIFICATION Section 7.1 Neither the City nor Velocity shall be liable to the other for any indirect, special, punitive or consequential damages arising under this Agreement or from any breach or partial breach of the provisions of this Agreement or arising out of any act or omission of either Party hereto, its directors, officers, employees, servants, contractors and/or agents. Section 7.2 Velocity assumes, releases and agrees to indemnify, defend, protect and save City (including its officers, agents, representatives and employees) harmless from and against any claim, damage, loss, liability, injury, cost and expense (including reasonable attorneys’ fees and expenses) in connection with any loss or damag e to any person or property arising out of or resulting in any way from the acts or omissions to act, negligence or willful misconduct of Velocity, its directors, officers, employees, servants, contractors and/or agents in connection with the exercise of its rights and obligations under the terms of this Agreement. The City assumes, releases and agrees to indemnify, defend, protect and save Velocity (including its officers, agents, representatives and employees) harmless from and against any claim, damage, loss, liability, injury, cost and expense (including reasonable attorneys’ fees and expenses) in connection with any loss or damage to any person or property arising out of or resulting in any way from the acts or omissions to act, negligence or willful misconduct of the City, its directors, officers, employees, servants, contractors and/or agents in connection with the exercise of its rights and obligations under the terms of this Agreement. Section 7.3 Nothing contained herein shall operate as a limitation on the right of either Party hereto to bring an action for damages, including consequential damages, against any third party based on any acts or omissions of such third party as such acts or omissions may affect the construction, operation or use of the Fiber, Cable, or IRU Fibers; provided, however, that (i) the Parties to this Agreement shall not have any claim against the other Party for indirect, incidental, special, punitive or consequential damages (including, but not limited to, any claim from any customer for loss of services), and (ii) each Party hereto shall assign such rights or claims, execute such documents and do whatever else may be reasonably necessary to enable the injured party to pursue any such action against such third party. 5 ARTICLE VIII FORCE MAJEURE The obligations of the Parties hereto are subject to force majeure and neither Party shall be in default under this Agreement if any failure or delay in performance is caused by strike or other labor dispute; accidents; acts of God; fire; flood; earthquake; lightning; unusually severe weather; material or facility shortages or unavailability not resulting from such party’s failure to timely place orders therefor; lack of transportation; acts of any governmental authority; condemnation or the exercise of rights of eminent domain; war or civil disorder; or any other cause beyond the reasonable control of either party hereto. The excused party shall use reasonable efforts under the circumstances to avoid or remove such causes of non-performance and shall proceed to perform with reasonable dispatch whenever such causes are removed or ceased. ARTICLE IX RELOCATION OF CABLE Section 9.1 The City shall have the right to relocate the IRU Cable at any time upon written notice to the other Party (a "Relocation"). The City shall be responsible for all costs associated with a Relocation of the IRU Fibers required by alteration of the Right-of-Way or by the request of a third party having authority to require the move. The City shall be responsible for the remaining costs associated with a Relocation required by alteration of the Right-of-Way or by the request of a third party having authority to require the move. The City may seek and receive funding or reimbursement from a third party for a Relocation by the City and Velocity shall have no right to such funds or reimbursements and shall not pursue a claim against such funds. Section 9.2 Either Party shall give the other Party at least sixty (60) days prior notice of any such Relocation, if possible. The relocating party shall have the right to determine the extent of, the timing of, and the methods to use for such Relocation; provided that any such relocated Cable, Fibers and Conduit shall be constructed and tested in accordance with industry standard specifications and requirements. In addition, the relocating party shall use reasonable efforts to ensure Relocation does not result in an adverse change to the operations, performance or connection points with the network of the other party, or end points of the applicable IRU Cable and Fibers. Section 9.3 Each Party has the right to review the Relocation plans at least fourteen (14) days prior to commencement of any Relocation. Either Party may submit comments on the Relocation plans, which comments shall not delay commencement of the Relocation. Both Parties shall have the right to have a representative present at the time a Relocation occurs. ARTICLE X CONFIDENTIALITY The Parties agree and recognize that this Agreement as well as information and documents the Parties receive from one another during the term of this Agreement may be considered public data under the Minnesota Government Data Practices Act, Minn. Stat. Ch 13. The Parties agree 6 to comply with the Minnesota Government Data Practices Act as it applies to all data provided by the Parties under this Agreement, and as it applies to all data created, collected, received, stored, used, maintained, or disseminated by any Party under this Agreement. The civil remedies of Minn. Stat. § 13.08 apply to the release of the data referred to in this clause by an y Party. If either Party receives a request to release data arising out of or related to the Facility or the use, operation or maintenance thereof, the Party receiving the request must immediately notify the other Party of the request. The Parties will promptly consult and discuss the best way to respond to the request. ARTICLE XI ABANDONMENT; TERMINATION; EFFECT OF TERMINATION Section 11.1 Should Velocity decide to abandon all or part of the IRU Fibers during the term of this Agreement, it may do so by providing sixty (60) days’ notice informing City in writing of its intent to abandon. Such abandonment shall be at no cost to either Party except as set forth in this Article. Section 11.2 This Agreement shall terminate upon the first to occur of the following: (a) Automatically upon the effective date abandonment by Velocity. (b) Upon written notice from either Party to the other if a default occurs that is not cured within the time allowed hereunder or an event of default occurs under Article 11, Section 11.2. Section 11.3 If this IRU terminates under Article 11, Section 11.2(a) neither Party shall have any liability to the other Party for the use of the IRU Fibers. If this Agreement terminates under Article 11, Section 11.2(b), the non-defaulting party shall not have any liability to the defaulting party, and the defaulting party shall be liable for such damages to the non-defaulting party as the non-defaulting party may establish in a court of law, except as limited by this Agreement. Upon termination of this Agreement for any reason, the Parties agree to promptly draft and execute any documents reasonably required to effect such termination. Section 11.4 Upon termination of this Agreement for any reason, Velocity shall cease to have any rights to the IRU Fibers or other rights under this Agreement or any obligations under this Agreement except for obligations under this Article and any other obligations that arose prior to such termination. ARTICLE XII DEFAULT Section 12.1 Neither Party shall be in default under this Agreement unless and until the other Party shall have given the defaulting party written notice of such default and the defaulting party shall have failed to cure the default within thirty (30) days after written receipt of such notice; provided, however, that where a default cannot be reasonably cured within the thirty (30) day period, if the defaulting party shall promptly proceed to cure the default with due diligence, the 7 time for curing the default shall be extended for a period of up to ninety (90) days from the date of receipt of the default notice or until the default is cured, whichever is shorter. Section 12.2 Upon the failure by the defaulting party to timely cure any default after notice thereof from the non-defaulting party, the non-defaulting party may take any action it determines, in its discretion, to be necessary to correct the default, and/or pursue any legal remedies it may have under applicable law or principles of equity relating to the breach. ARTICLE XIII NOTICES Section 13.1 Unless otherwise provided herein, all notices and communications concerning this Agreement shall be in writing and addressed as follows: If to the City: City of Eagan Attn: IT Department 3830 Pilot Knob Road Eagan, MN 55122 With a copy to: City Attorney Dougherty, Molenda, Solfest, Hills & Bauer P.A. 14985 Glazier Avenue, Suite 525 Apple Valley, MN 55124 If to Velocity: Velocity Telephone, Incorporated 656 Mendelssohn Ave N Golden Valley, MN 55427 Section 13.2 Unless otherwise provided herein, notices shall be sent by certified U.S. Mail, return receipt requested; or by commercial overnight delivery service which provides acknowledgment of delivery; or via email and with confirmation receipt; or by facsimile, and shall be deemed delivered: if sent by U.S. Mail, five (5) days after deposit; if sent by facsimile, or commercial overnight delivery service, upon verification of receipt. ARTICLE XIV LIMITATION ON CITY PROPERTY INTEREST This Agreement does not grant Velocity any property interest or estate in or lien upon the City’s property, Optical Fiber Network or any components thereof or any Intellectual Property, except for use of the IRU Fibers during the term of this Agreement. All liens, claims and charges of Velocity at any time shall not attach to any interest of the City or in any property owned by the City. 8 ARTICLE XV GOVERNING LAW AND VENUE This Agreement shall be governed and construed in accordance with the laws of the State of Minnesota without regard to its conflict of laws provision. The Parties agree that any action arising out of this Agreement or with respect to the enforcement of this Agreement shall be venued in the Dakota County District Court, State of Minnesota. ARTICLE XVI INDEPENDENT CONTRACTOR The performance by Velocity and the City of all duties and obligations under this Agreement shall be as independent contractors and not as agents of the other Party, and no persons employed or utilized by a performing party shall be considered the employees or agents of the other. Neither Party shall have the authority to enter into any agreement purporting to bind the other without its specific written authorization. The Parties agree that this Agreement does not create a partnership between, or a joint venture of Velocity and the City. ARTICLE XVII MISCELLANEOUS Section 17.1 The headings of the Articles in this Agreement are strictly for convenience and shall not in any way be construed as amplifying or limiting any of the terms, provisions or conditions of this Agreement. Section 17.2 In construction of this Agreement, words used in the singular shall include the plural and the plural, the singular, and “of’ is used in the inclusive sense, in all cases where such meanings would be appropriate. Section 17.3 If any provision of this Agreement is found by any court of competent jurisdiction to be invalid or unenforceable, then the parties hereby waive such provision to the extent that it is found to be invalid or unenforceable and to the extent that to do so would not deprive one of the parties of the substantial benefit of its bargain. Such provision, t o the extent allowable by law and the preceding sentence, shall not be voided or canceled, but instead will be modified by such court so that it becomes enforceable with all of the other terms of this Agreement continuing in full force and effect. Section 17.4 This Agreement may be amended only by a written instrument executed by all Parties. Section 17.5 No failure to exercise and no delay in exercising, on the part of either Party hereto, any right, power or privilege hereunder shall operate as a waiver hereof, except as expressly provided herein. Any waiver by either Party of a breach of any provision of this Agreement shall not be deemed to be a waiver of any other or subsequent breach and shall not be construed to be a modification of the terms of this Agreement unless and until agreed to in writing by both Parties. 9 Section 17.6 In the event of a conflict between the provisions of this Agreement and those of the Exhibits, the provisions of the Exhibits shall prevail and the Agreement will be deemed corrected accordingly. Section 17.7 This Agreement has been fully negotiated between and jointly drafted by the parties. Section 17.8 All actions, activities, consents, approvals and other undertakings of the parties in this IRU shall be performed in a reasonable and timely manner. Section 17.9 Unless expressly defined herein, words having well known technical or trade meanings shall be so construed. Section 17.10 This Agreement is solely for the benefit of the parties hereto and their permitted successors and assigns. ARTICLE XVIII ENTIRE AGREEMENT This Agreement, any Exhibits referenced and attached hereto or to be attached hereto, constitutes the entire agreement between the Parties with respect to the subject matter hereof and supersede any and all prior negotiations, understandings and agreements with respect hereto, whether oral or written. IRU GRANTOR: IRU GRANTEE: CITY OF EAGAN VELOCITY TELEPHONE, INCORPORATED By: ________________________ By: Mike Maguire __________________________ Its: Mayor Its: _______________________ By: Elizabeth VanHoose Its: Clerk Todd Mueller Todd Mueller VP Operations EXHIBIT A Segment 1 EXHIBIT B Description of Fiber Details, Ownership, and Use Segment 1 – The Flats at Cedar Grove to Velocity Meet via DataBank This segment consists of 1 dark strand of fiber from The Flats at Cedar Grove (3825 Cedar Grove Pkwy, Eagan, MN 55122) to the Velocity/Eagan field meet HH13 (NW corner Eagandale Blvd & West Service Rd). The City will own and maintain the fiber in Segment 1. Velocity will have use of the following 1 strand of fiber within the cables: • Strand 1 of 12ct cable from The Flats at Cedar Grove data room north to Handhole at NW corner of Silver Bell Rd & Nicols Rd (HH61). • Strand 7 of 144ct cable north from HH61 to HH23 (SW corner of Yankee Doodle Rd & Blue Cross Rd). • Strand 79 of 144ct cable east from HH23 to HH137 (NW corner of Yankee Doodle Rd & Central Pkwy). • Strand 19 of 144ct cable east from HH137 to DataBank south meet-me-room circuit 19 (3255 Neil Armstrong Blvd). • Strand 61 of 144ct cable from DataBank south meet-me-room to DataBank north meet- me-room. • Strand 61 of 144ct cable north from DataBank north meet-me-room circuit 493 to HH123 (SE corner of Lone Oak Rd & Lexington Ave). • Strand 1 of 48ct north from HH123 to HH17 (NW corner of Eagandale Blvd & Eagan Industrial Rd). • Strand 61 of 144ct south from HH17 to HH13 (NW corner Eagandale Blvd & West Service Rd). FIBER OPTIC INDEFEASIBLE RIGHT TO USE THIS FIBER OPTIC INDEFEASIBLE RIGHT TO USE together with any attached exhibits (collectively the “Agreement”) made and entered into by and between the City of Eagan, a Minnesota municipal corporation (“IRU Grantor” or “the City”), and Velocity Telephone, Incorporated, a Minnesota corporation (“IRU Grantee” or “Velocity”). The IRU Grantor and IRU Grantee may be referred to herein individually as a “Party” or collectively as the “Parties.” BACKGROUND A. Velocity desires to lease Fibers from the City as described in this Agreement; and B. The City agrees to grant to Velocity the right to use specific Fibers within certain Fiber Optic Cable segments on the terms and conditions set forth below. DEFINITIONS The following terms are used in this IRU: A. “Effective Date” is the date upon which all Parties have executed this Agreement. B. “Fiber” means a glass strand or strands which is/are used to transmit a communication signal along the glass strand in the form of pulses of light. C. “Fiber Optic Cable” or “Cable” means a collection of fibers with a protective outer covering. D. “IRU Cable” means a Cable containing one or more Fibers, constructed and owned by the City in which the IRU Grantee has an IRU pursuant to the terms of this Agreement. E. “IRU Fibers” means the specific City owned Fiber described further herein, an IRU for which is granted to the IRU Grantee in the IRU Cable. F. “Indefeasible Right of Use” or “IRU” means an indefeasible right to use the IRU Fibers, provided, however, that granting of such IRU does not convey legal title to the IRU Fibers. G. “Optical Splice Point” means a point where the IRU Grantee’s Cable is connected to the City’s Cable within a splice enclosure. H. “Relocation” means any physical movement of fiber optic cable or conduit required due to reconstruction, modification, change in grade, expansion or relocation of a County road or highway, or a city street. I. “Right of Way” means the real property, including all fee simple, easements, access rights, rights of use and other interests devoted to road or highway purposes. 2 In consideration of their mutual promises, the parties expressly agree as follows: ARTICLE I LICENSES Section 1.1 Velocity desires to obtain an IRU in the IRU Fibers further described in Exhibit B to this Agreement, which is incorporated into this IRU by reference. In consideration of the promises by Velocity in this Agreement, the City grants an IRU to Velocity in the IRU Cable identified in Exhibit A hereto. The City shall deliver to Velocity the right to use the IRU Fibers, including, but not limited to, handholes, splice enclosures, and related equipment but excluding any electronic or optronic equipment at termination points. Prior to use, Velocity shall coordinate with City the use of any handholes and splice enclosures required for the IRU Fibers, as well as coordinate when splicing will be performed. Velocity shall be entitled to use the IRU Fibers for any lawful purposes subject to (i) agreeing to be bound by all laws, regulations and any requirements of the City regarding access to City rights of way, and (ii) otherwise complying with the terms and conditions of this IRU. Section 1.2 Subject to the terms and conditions of this Agreement, City hereby grants to Velocity a license to access and use the IRU Fibers within the Fiber Optic Cable segments described below during the term of this Agreement. The specific strands subject to this IRU segment are identified in Exhibit B. Section 1.3 The IRU Fibers are being leased to Velocity “as is.” If there is any equipment needed (e.g. splice cases, handholes, etc.) or any fiber splices needed to interconnect fiber cables, Velocity shall be responsible for coordinating its work with the City and shall pay any and all costs and fees associated with connecting the IRU Fibers to Velocity’s fibers. Section 1.4 Notwithstanding anything contained to the contrary in this Agreement, the Parties acknowledge and agree that nothing contained in this Agreement shall operate to limit, interfere with, or otherwise adversely affect each Party’s right to manage, control, construct, relocate, maintain, replace and expand their fiber optic network equipment and infrastructure that either may deem necessary or desirable in its sole discretion, subject only to the IRU and Velocity’s license to the IRU Fibers. ARTICLE II EFFECTIVE DATE AND TERM Velocity shall be entitled to use the IRU Fibers granted by the City upon the Effective Date. The term of this Agreement shall be for a monthly auto renewal unless terminated in writing by the Parties by 60 days prior notice, or one of the events set forth in Article 11, Section 11.2 of this Agreement occurs, whichever is first. 3 ARTICLE III LICENSE FEES Velocity shall be charged a monthly fee for use of IRU Fibers of Seventy-five Dollars and no/100 Dollars ($75.00) per strand mile per month for a total of Five Hundred Eighty Nine Dollars and 50/100 Dollars ($589.50) due each month, which shall be payable in advance on or before the 1st of each month. ARTICLE IV MAINTENANCE AND REPAIR The City has already installed the Cable and all equipment necessary to connect Velocity’s Cable to its fiber optic network. The City shall be fully responsible for maintaining and repairing the Cable spliced into the IRU Fibers that connects the Cable to Velocity’s fiber optic network and associated equipment. ARTICLE V SPLICING Velocity shall be responsible for the cost of the initial splicing of Velocity’s Fibers at any Optical Splice Points and any additional splicing equipment that it requires to connect fibers to its optical fiber network. Velocity must obtain the City’s written consent prior to splicing any City owned Cable. ARTICLE VI REPRESENTATIONS AND WARRANTIES Section 6.1 Velocity warrants that its use of the IRU Fibers shall comply with all applicable governmental codes, ordinances, laws, rules, regulations and/or restrictions. Section 6.2 The City represents and warrants that it has the right to grant this IRU in the IRU Fibers. Section 6.3 Velocity’s sole and exclusive remedy and the City’s sole and exclusive maximum liability under this Agreement for failure of the IRU Fibers shall be, at the sole option of the City, to repair or replace any defective portion of the IRU Fibers, provided that the City is promptly notified in writing upon discovery by Velocity that any portion of the IRU Fibers has failed to conform with the terms of this IRU, such writing to include an explanation of alleged failures. Section 6.4 Neither Party’s warranties extend to defects caused by acts of God, accident, fire or other hazard, or by any misuse, neglect, alterations, storage, attempts to repair, or use of other supplies not meeting specifications. 4 THE FOREGOING WARRANTIES AND REMEDIES CONSTITUTE THE ONLY WARRANTIES WITH RESPECT TO THE IRU FIBERS. SUCH WARRANTIES ARE IN LIEU OF ALL OTHER WARRANTIES, WRITTEN OR ORAL, STATUTORY, EXPRESS OR IMPLIED, INCLUDING WITHOUT LIMITATION, ANY WARRANTY OF MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE. NEITHER PARTY SHALL IN ANY EVENT BE LIABLE FOR ANY INCIDENTAL, SPECIAL, OR CONSEQUENTIAL DAMAGES OF ANY NATURE WHATSOEVER FOR ANY REASON. ARTICLE VII LIABILITY; INDEMNIFICATION Section 7.1 Neither the City nor Velocity shall be liable to the other for any indirect, special, punitive or consequential damages arising under this Agreement or from any breach or partial breach of the provisions of this Agreement or arising out of any act or omission of either Party hereto, its directors, officers, employees, servants, contractors and/or agents. Section 7.2 Velocity assumes, releases and agrees to indemnify, defend, protect and save City (including its officers, agents, representatives and employees) harmless from and against any claim, damage, loss, liability, injury, cost and expense (including reasonable attorneys’ fees and expenses) in connection with any loss or damage to any person or property arising out of or resulting in any way from the acts or omissions to act, negligence or willful misconduct of Velocity, its directors, officers, employees, servants, contractors and/or agents in connection with the exercise of its rights and obligations under the terms of this Agreement. The City assumes, releases and agrees to indemnify, defend, protect and save Velocity (including its officers, agents, representatives and employees) harmless from and against any claim, damage, loss, liability, injury, cost and expense (including reasonable attorneys’ fees and expenses) in connection with any loss or damage to any person or property arising out of or resulting in any way from the acts or omissions to act, negligence or willful misconduct of the City, its directors, officers, employees, servants, contractors and/or agents in connection with the exercise of its rights and obligations under the terms of this Agreement. Section 7.3 Nothing contained herein shall operate as a limitation on the right of either Party hereto to bring an action for damages, including consequential damages, against any third party based on any acts or omissions of such third party as such acts or omissions may affect the construction, operation or use of the Fiber, Cable, or IRU Fibers; provided, however, that (i) the Parties to this Agreement shall not have any claim against the other Party for indirect, incidental, special, punitive or consequential damages (including, but not limited to, any claim from any customer for loss of services), and (ii) each Party hereto shall assign such rights or claims, execute such documents and do whatever else may be reasonably necessary to enable the injured party to pursue any such action against such third party. 5 ARTICLE VIII FORCE MAJEURE The obligations of the Parties hereto are subject to force majeure and neither Party shall be in default under this Agreement if any failure or delay in performance is caused by strike or other labor dispute; accidents; acts of God; fire; flood; earthquake; lightning; unusually severe weather; material or facility shortages or unavailability not resulting from such party’s failure to timely place orders therefor; lack of transportation; acts of any governmental authority; condemnation or the exercise of rights of eminent domain; war or civil disorder; or any other cause beyond the reasonable control of either party hereto. The excused party shall use reasonable efforts under the circumstances to avoid or remove such causes of non-performance and shall proceed to perform with reasonable dispatch whenever such causes are removed or ceased. ARTICLE IX RELOCATION OF CABLE Section 9.1 The City shall have the right to relocate the IRU Cable at any time upon written notice to the other Party (a "Relocation"). The City shall be responsible for all costs associated with a Relocation of the IRU Fibers required by alteration of the Right-of-Way or by the request of a third party having authority to require the move. The City shall be responsible for the remaining costs associated with a Relocation required by alteration of the Right-of-Way or by the request of a third party having authority to require the move. The City may seek and receive funding or reimbursement from a third party for a Relocation by the City and Velocity shall have no right to such funds or reimbursements and shall not pursue a claim against such funds. Section 9.2 Either Party shall give the other Party at least sixty (60) days prior notice of any such Relocation, if possible. The relocating party shall have the right to determine the extent of, the timing of, and the methods to use for such Relocation; provided that any such relocated Cable, Fibers and Conduit shall be constructed and tested in accordance with industry standard specifications and requirements. In addition, the relocating party shall use reasonable efforts to ensure Relocation does not result in an adverse change to the operations, performance or connection points with the network of the other party, or end points of the applicable IRU Cable and Fibers. Section 9.3 Each Party has the right to review the Relocation plans at least fourteen (14) days prior to commencement of any Relocation. Either Party may submit comments on the Relocation plans, which comments shall not delay commencement of the Relocation. Both Parties shall have the right to have a representative present at the time a Relocation occurs. ARTICLE X CONFIDENTIALITY The Parties agree and recognize that this Agreement as well as information and documents the Parties receive from one another during the term of this Agreement may be considered public data under the Minnesota Government Data Practices Act, Minn. Stat. Ch 13. The Parties agree 6 to comply with the Minnesota Government Data Practices Act as it applies to all data provided by the Parties under this Agreement, and as it applies to all data created, collected, received, stored, used, maintained, or disseminated by any Party under this Agreement. The civil remedies of Minn. Stat. § 13.08 apply to the release of the data referred to in this clause by any Party. If either Party receives a request to release data arising out of or related to the Facility or the use, operation or maintenance thereof, the Party receiving the request must immediately notify the other Party of the request. The Parties will promptly consult and discuss the best way to respond to the request. ARTICLE XI ABANDONMENT; TERMINATION; EFFECT OF TERMINATION Section 11.1 Should Velocity decide to abandon all or part of the IRU Fibers during the term of this Agreement, it may do so by providing sixty (60) days’ notice informing City in writing of its intent to abandon. Such abandonment shall be at no cost to either Party except as set forth in this Article. Section 11.2 This Agreement shall terminate upon the first to occur of the following: (a) Automatically upon the effective date abandonment by Velocity. (b) Upon written notice from either Party to the other if a default occurs that is not cured within the time allowed hereunder or an event of default occurs under Article 11, Section 11.2. Section 11.3 If this IRU terminates under Article 11, Section 11.2(a) neither Party shall have any liability to the other Party for the use of the IRU Fibers. If this Agreement terminates under Article 11, Section 11.2(b), the non-defaulting party shall not have any liability to the defaulting party, and the defaulting party shall be liable for such damages to the non-defaulting party as the non-defaulting party may establish in a court of law, except as limited by this Agreement. Upon termination of this Agreement for any reason, the Parties agree to promptly draft and execute any documents reasonably required to effect such termination. Section 11.4 Upon termination of this Agreement for any reason, Velocity shall cease to have any rights to the IRU Fibers or other rights under this Agreement or any obligations under this Agreement except for obligations under this Article and any other obligations that arose prior to such termination. ARTICLE XII DEFAULT Section 12.1 Neither Party shall be in default under this Agreement unless and until the other Party shall have given the defaulting party written notice of such default and the defaulting party shall have failed to cure the default within thirty (30) days after written receipt of such notice; provided, however, that where a default cannot be reasonably cured within the thirty (30) day period, if the defaulting party shall promptly proceed to cure the default with due diligence, the 7 time for curing the default shall be extended for a period of up to ninety (90) days from the date of receipt of the default notice or until the default is cured, whichever is shorter. Section 12.2 Upon the failure by the defaulting party to timely cure any default after notice thereof from the non-defaulting party, the non-defaulting party may take any action it determines, in its discretion, to be necessary to correct the default, and/or pursue any legal remedies it may have under applicable law or principles of equity relating to the breach. ARTICLE XIII NOTICES Section 13.1 Unless otherwise provided herein, all notices and communications concerning this Agreement shall be in writing and addressed as follows: If to the City: City of Eagan Attn: IT Department 3830 Pilot Knob Road Eagan, MN 55122 With a copy to: City Attorney Dougherty, Molenda, Solfest, Hills & Bauer P.A. 14985 Glazier Avenue, Suite 525 Apple Valley, MN 55124 If to Velocity: Velocity Telephone, Incorporated 656 Mendelssohn Ave N Golden Valley, MN 55427 Section 13.2 Unless otherwise provided herein, notices shall be sent by certified U.S. Mail, return receipt requested; or by commercial overnight delivery service which provides acknowledgment of delivery; or via email and with confirmation receipt; or by facsimile, and shall be deemed delivered: if sent by U.S. Mail, five (5) days after deposit; if sent by facsimile, or commercial overnight delivery service, upon verification of receipt. ARTICLE XIV LIMITATION ON CITY PROPERTY INTEREST This Agreement does not grant Velocity any property interest or estate in or lien upon the City’s property, Optical Fiber Network or any components thereof or any Intellectual Property, except for use of the IRU Fibers during the term of this Agreement. All liens, claims and charges of Velocity at any time shall not attach to any interest of the City or in any property owned by the City. 8 ARTICLE XV GOVERNING LAW AND VENUE This Agreement shall be governed and construed in accordance with the laws of the State of Minnesota without regard to its conflict of laws provision. The Parties agree that any action arising out of this Agreement or with respect to the enforcement of this Agreement shall be venued in the Dakota County District Court, State of Minnesota. ARTICLE XVI INDEPENDENT CONTRACTOR The performance by Velocity and the City of all duties and obligations under this Agreement shall be as independent contractors and not as agents of the other Party, and no persons employed or utilized by a performing party shall be considered the employees or agents of the other. Neither Party shall have the authority to enter into any agreement purporting to bind the other without its specific written authorization. The Parties agree that this Agreement does not create a partnership between, or a joint venture of Velocity and the City. ARTICLE XVII MISCELLANEOUS Section 17.1 The headings of the Articles in this Agreement are strictly for convenience and shall not in any way be construed as amplifying or limiting any of the terms, provisions or conditions of this Agreement. Section 17.2 In construction of this Agreement, words used in the singular shall include the plural and the plural, the singular, and “of’ is used in the inclusive sense, in all cases where such meanings would be appropriate. Section 17.3 If any provision of this Agreement is found by any court of competent jurisdiction to be invalid or unenforceable, then the parties hereby waive such provision to the extent that it is found to be invalid or unenforceable and to the extent that to do so would not deprive one of the parties of the substantial benefit of its bargain. Such provision, to the extent allowable by law and the preceding sentence, shall not be voided or canceled, but instead will be modified by such court so that it becomes enforceable with all of the other terms of this Agreement continuing in full force and effect. Section 17.4 This Agreement may be amended only by a written instrument executed by all Parties. Section 17.5 No failure to exercise and no delay in exercising, on the part of either Party hereto, any right, power or privilege hereunder shall operate as a waiver hereof, except as expressly provided herein. Any waiver by either Party of a breach of any provision of this Agreement shall not be deemed to be a waiver of any other or subsequent breach and shall not be construed to be a modification of the terms of this Agreement unless and until agreed to in writing by both Parties. 9 Section 17.6 In the event of a conflict between the provisions of this Agreement and those of the Exhibits, the provisions of the Exhibits shall prevail and the Agreement will be deemed corrected accordingly. Section 17.7 This Agreement has been fully negotiated between and jointly drafted by the parties. Section 17.8 All actions, activities, consents, approvals and other undertakings of the parties in this IRU shall be performed in a reasonable and timely manner. Section 17.9 Unless expressly defined herein, words having well known technical or trade meanings shall be so construed. Section 17.10 This Agreement is solely for the benefit of the parties hereto and their permitted successors and assigns. ARTICLE XVIII ENTIRE AGREEMENT This Agreement, any Exhibits referenced and attached hereto or to be attached hereto, constitutes the entire agreement between the Parties with respect to the subject matter hereof and supersede any and all prior negotiations, understandings and agreements with respect hereto, whether oral or written. IRU GRANTOR: IRU GRANTEE: CITY OF EAGAN VELOCITY TELEPHONE, INCORPORATED By: ________________________ By: Mike Maguire __________________________ Its: Mayor Its: _______________________ By: Elizabeth VanHoose Its: Clerk Todd Mueller VP Operations Todd Mueller EXHIBIT A Segment 1 EXHIBIT B Description of Fiber Details, Ownership, and Use Segment 1 – Eagan HH151 to Velocity Meet via DataBank This segment consists of 2 dark strands of fiber from Eagan HH151 (SE corner of Pilot Knob Rd & Crestridge LN) to the Velocity/Eagan field meet HH13 (NW corner Eagandale Blvd & West Service Rd). The City will own and maintain the fiber in Segment 1. Velocity will have use of the following 2 strands of fiber within the cables: • Strands 3-4 of 144ct cable from Eagan HH151 (SE corner of Pilot Knob Rd & Crestridge LN) east to DataBank south meet-me-room circuits 3-4 (3255 Neil Armstrong Blvd). • Strands 11-12 of 144ct cable from DataBank south meet-me-room to DataBank north meet-me-room. • Strands 67-68 of 144ct cable north from DataBank north meet-me-room circuit 499- 500 to HH123 (SE corner of Lone Oak Rd & Lexington Ave). • Strands 7-8 of 48ct north from HH123 to HH17 (NW corner of Eagandale Blvd & Eagan Industrial Rd). • Strands 67-68 of 144ct south from HH17 to HH13 (NW corner Eagandale Blvd & West Service Rd). Agenda Information Memo April 5, 2022, Eagan City Council Meeting CONSENT AGENDA F. Approve temporary on-sale liquor licenses for the Twin Cities Goodtime Softball League on May 28 and 29, 2022 at Northview Park and Lexington/Diffley Athletic Fields Action To Be Considered: To approve a temporary on-sale liquor license for the Twin Cities Goodtime Softball League’s North Star Classic on May 28 and 29, 2022 at Northview Park, 980 Northview Park Road, and Lexington/Diffley Athletic Fields, 4201 Lexington Ave S. Facts: The Twin Cities Goodtime Softball League, a non-profit organization based in Minneapolis, has applied for a temporary on-sale liquor license for its softball tournament, the North Star Classic, scheduled for May 28 and 29, 2022 at the Lexington-Diffley Athletic Complex and Northview Athletic Fields. The North Star Classic Tournament has been held in Eagan since 2004. The organization has met the requirements for a temporary on-sale liquor license and has submitted the required documentation. The application has been reviewed by staff and the Police Department and has been found in order for approval. Following Council approval, the application will be forwarded to the Department of Public Safety – Alcohol and Gambling Enforcement Division for final approval. Attachments: (0) Agenda Information Memo April 5, 2022, Eagan City Council Meeting CONSENT AGENDA G. Approve a Resolution establishing new precinct boundaries and polling locations and reestablish existing precinct boundaries and polling locations for the 2022 Legislative Redistricting Action To Be Considered: To approve a Resolution establishing new precinct boundaries and polling locations and reestablishing existing precinct boundaries and polling locations for the 2022 Legislative Redistricting Facts: ➢ In response to the redistricting that has occurred at the State level, the City is required by State Statute to take formal action to establish and reestablish its precincts. ➢ Legislative boundary changes triggered shifts in almost all precinct boundaries throughout Eagan except Precinct 16 which still contains existing boundaries. ➢ A few adjustments have been made to the map since the latest draft was provided to council for review. The following changes were made: o School district boundaries on the west side of the city posed a challenge for city precinct boundaries. Since there is no longer a requirement that precinct boundaries follow physical features, we were able to adjust the boundary lines around Precinct 3 and Precinct 6 and the northwest corner of Precinct 9 using school district boundaries and census tract boundaries. o In our attempt to even out registered voter totals within each precinc t, this produced changes from the draft map within boundaries around Precinct 1 and Precinct 5. ➢ Limitations to polling location availability caused the need to eliminate two Precincts going from 20 Precincts to 18 Precincts. ➢ The City Clerk will work with Dakota County and the City’s Communications team to ensure that all Eagan voters are notified of their precinct and/or polling location change. ➢ Upon City Council approval, the City Clerk will follow all necessary statutory notification requirements with Dakota County and the State Attachments: (3) CG-1 Resolution CG-2 Proposed 2022 Precinct Boundaries and Polling Places CG-3 2012 Precinct Map (for comparison) CITY OF EAGAN RESOLUTION NO. RESOLUTION ESTABLISHING NEW PRECINCT BOUNDARIES AND POLLING LOCATION AND REESTABLISHING EXISTING PRECINCT BOUNDARIES AND POLLING LOCATIONS WHEREAS, the legislature of the State of Minnesota has been redistricted; and WHEREAS, Minnesota Statute section 204B.14, subd. 3 (d) requires that precinct boundaries must be reestablished within 60 days of when the legislature has been redistricted orat least 19 weeks before the state primary election, whichever comes first; NOW, THEREFORE, BE IT RESOLVED that the City Council of the City of Eagan, County of Dakota, State of Minnesota hereby reestablishes the boundaries of the voting precincts and polling places as follows: Precinct 1 (Trinity School at River Ridge, 601 River Ridge Parkway) That part of the City south of the City’s northern corporate boundary, east of Interstate Highway 35E, south of Lone Oak Road, east of Lexington Avenue, north of Yankee Doodle Road, east of Wescott Woodlands, east of trail between Wescott Woodlands and Wescott Hills Drive, east of Wescott Hills Drive, north of Wescott Rd and west of the City’s eastern corporate boundary. Precinct 2 (Eagan Community Center-South Oaks, 1501 Central Parkway) That part of the City south of the City’s northern corporate boundary, east of State Highway 13, north of Four Oaks Road, east of Coachman Road, north of Yankee Doodle Road and west of Interstate Highway 35E. Precinct 3 (Oak Hills Church, 1570 Yankee Doodle Road) That part of the City east of State Highway 13, south of Four Oaks Road, west of Coachman Road, south of Yankee Doodle Road, west of Interstate 35E, north and east of a line between the boundary of ISD 197 and ISD 196 and north of Blackhawk Road. Precinct 4 (Mt Calvary Lutheran Church, 3930 Rahn Road) That part of the City east of State Hwy 13, south of Blackhawk Rd to south and west of a line between ISD 191 and ISD 197 to south of Riverton Avenue to south of a line along border between ISD 197 and ISD 196 to Interstate 35E, north of Deerwood Drive, east of Blackhawk Road, north of Turquoise Trail, east of Serpentine Drive, north of Gold Trail, east of Cedar Grove Parkway. Precinct 5 (Eagan Fire Safety Center, 1001 Station Trail) That part of the City east of Interstate 35E, south of Lone Oak Road, west of Lexington Avenue, south of Yankee Doodle Road, west of Wescott Woodlands, and north of Duckwood Drive. Precinct 6 (Cedar School, 2140 Diffley Road) That part of the City east of the western corporate boundary, north of Diffley Road, west of Rahn Road, west of Cedar Grove Parkway, north and west of State Hwy 13, south of the northern corporate boundary . Precinct 7 (Eagan Civic Arena, 3870 Pilot Knob Road) That part of the City east of Interstate 35E, south of Duckwood Drive, west of Denmark Avenue, south of Wescott Road, west of Lexington Avenue, north of a line extending due west from Lexington Avenue to Deerwood Drive through Patrick Eagan Park along city parcel boundaries, north of Deerwood Drive, west of Pilot Knob Road, north of Diffley Road. Precinct 8 (Wescott Library, 1340 Wescott Road) That part of the City south of Deerwood Drive, west of Wescott Woodlands, west of trail between Wescott Woodlands and Wescott Hills Drive, west of Wescott Hills Drive, north of Wescott Road, west of North Ridge Drive, north of Northview Park Road, east of Lexington Avenue, north of Wescott Road and east of Denmark Avenue. Precinct 9 (Christ Lutheran Church, 1930 Diffley Road) That part of the City east of Rahn Road, south and east of Cedar Grove Parkway, south of Gold Trail, west of Serpentine Drive, south of Turquoise Trail, west of Blackhawk Road, south of Deerwood Drive, west of Interstate 35E and north of Diffley Road. Precinct 10 (Saints Marth and Mary Church, 4180 Lexington Avenue) That part of the City south of Wescott Road, west of Dodd Road, north of Diffley Road, east of Lexington Avenue, south of Northview Park Road, east of North Ridge Drive. Precinct 11 (Peace Church, 2180 Glory Drive) That part of the City south of Diffley Road, west of Nicols Road, south of Cliff Road, west of Interstate 35E, north of the southern corporate border and east of the western corporate border. Precinct 12 (Rahn Elementary School, 4424 Sandstone Drive) That part of the City south of Diffley Road, west of Interstate 35E, north of Cliff Road and east of Nicols Road. Precinct 13 (Easter Lutheran By The Lake, 4545 Pilot Knob Road) That part of the City south of Diffley Road, west of Pilot Knob Road, north of Cliff Road (boundary between Minnesota House Districts 52A and 52B), east of Interstate 35E Precinct 14 (Easter Lutheran Church, 4200 Pilot Knob Road) That part of the City south of Deerwood Drive, south of a line extending due east from Deerwood Drive to Lexington Avenue through Patrick Eagan Park along city parcel boundaries, west of Lexington Avenue, north of Cliff Road, east of Pilot Knob Road. Precinct 15 (Faith in Christ Fellowship Church, 670 Diffley Road) That part of the City south of Diffley Road, west of Dodd Road, north of Cliff Road (boundary between Minnesota House District 52B and 56B), east of Lexington Avenue. Precinct 16 (St. Thomas Becket Church, 4455 South Robert Trail) That part of the City east of Dodd Road, west of the eastern corporate border, north of Cliff Road (boundary between Minnesota House District 52B and 56B). Precinct 17 (Chapel Hill Church, 4888 Pilot Knob Road) That part of the City south of Cliff Road (boundary between Minnesota House Districts 52A and 52B), west of boundary between Minnesota House District 52A and 56B, north of the southern corporate border, east of Interstate 35E. Precinct 18 (Lebanon Hills Visitor Center, 860 Cliff Road) That part of the City east of the boundary between Minnesota House District 52A and 56B, south of Cliff Road (boundary between Minnesota House District 52B and 56B), west of the eastern corporate border, north of the southern corporate border. Motion by: Seconded by: Those in favor: Those against: Date: CITY OF EAGAN By: Its Mayor Attest: Its City Clerk CLIFF RD DIFFLEY RD YANKEE DOODLE RD HWY 149LEXINGTON AVEPILOT KNOB RDHWY 77HWY 13I - 35EHWY 55 I - 494 PILOT KNOB RDCLIFF RD LONE OAK RD " " " " " " "" " " " " " " " " " " ST THOMAS BECKET EAG AN FIRE SAFETY CENTER OAK HILLS CHURCH EAGAN CIVIC ARENA EASTER LUTHERAN CHURCH FAITH IN CHRIST CHURCH STS MARTHA AND MARY LEBANON HILLS VISITO RS CENTER CHRIST LUTHERAN CHURCH CHAPEL HILL CHURCH RAHN ELEMENTARY SCHO OL CEDAR ELEMENTARY SCHOO L PEACE CHURCH MT CALVARY LUTHERAN CHURCH TRINITY SCHOOL AT RIVER RIDGE EAGAN COMMUNITY CENTER EASTER BY THE LAKE 56B 52A 52B WESCOTT LIBRARY P1P1 P5P5 P2P2 P3P3 P4P4 P9P9 P10P10 P11P11 P6P6 P12P12 P13P13 P15P15 P16P16 P17P17 P18P18 P8P8 P14P14 P7P7 1 2 5 6 3 4 87 10 11 12 9 13 14 17 15 18 16 2022 Precincts-Draft Legend Eagan P recinct Boundary "Polling Location-Proposed State House District Boundary-New " " " " " " """ " " " "" " " " " " " ST THOMAS BECKET EAG AN FIRE SAFETY CENTER OAK HILLS CHURCH EAGAN CIVIC ARENA EASTER LUTHERAN CHURCH FAITH IN CHRIST CHURCH STS MARTHA AND MARY LEBANON HILLS VISITO RS CENTER CHRIST LUTHERAN CHURCH CHAPEL HILL CHURCH RAHN ELEMENTARY SCHO OL CEDAR ELEMENTARY SCHOO L PEACE CHURCH MT CALVARY LUTHERAN CHURCH TRINITY SCHOOL AT RIVER RIDGE EAGAN COMMUNITY CENTER EASTER BY THE LAKE 52B 51A 51B WESCOTT LIBRARY EAG AN CITY HALL 8 7 4 3 2 1 17 16 1513 12 11 10 9B 9A 6A6B 5B 5AP4 P3 P1 P16 P2 P8P6B P13 P7P5A P9A P9B P6A P17 P14P12 P5B P15P11P10 14 2021 Precincts-Current Legend "Polling location-current State House District Boundary-Current Agenda Information Memo April 5, 2022, Eagan City Council Meeting CONSENT AGENDA H. Approval Of A Request To Accept A Surplus M-ATV Action To Be Considered: Approval of a request to accept a surplus M-ATV Facts: ➢ The police department procures surplus equipment from the Law Enforcement Support Office (LESO), which is a state-run program. ➢ The police department is interested in obtaining a M-ATV through the LESO program. ➢ The estimated value of the vehicle is $400,000, however the city would only have to commit to paying a transport fee to acquire the vehicle, which would be in the range of $3000-$5,000. ➢ The M-ATV is intended to provide a safe refuge from citizens and officers during rapidly involving incidents involving guns. The vehicle will also provide a means to slow down the actions of police during these dynamic situations. Agenda Information Memo April 5, 2022, Eagan City Council Meeting CONSENT AGENDA I. Approve a Resolution to Accept Donation Action To Be Considered: To approve a resolution to accept donations. Facts: ➢State Statute requires the Mayor and City Council to accept donations to the City via a resolution. ➢The City has received the following donations: •$580 from Constance Miller for a log memorial bench to be placed at Thomas Lake Park Attachments: (1) CI-1 Resolution RESOLUTION NO. 22-__ CITY OF EAGAN Accept Donations WHERAS, the City of Eagan is generally authorized to accept donations of real and personal property pursuant to Minnesota Statutes Section 465.03 for the benefits of its citizens, and is specifically authorized to accept gifts; and WHEREAS, the following persons and entities have offered to contribute the following donations set forth below to the City: Donation WHEREAS, all such donations have been contributed to the City for the benefit of its citizens, as allowed by law; and WHEREAS, the City Council finds that it is appropriate to accept the donations offered. NOW, THEREFORE, BE IT RESOLVED that the City Council of Eagan, Dakota County, Minnesota, hereby accepts the donations described above. CITY OF EAGAN CITY COUNCIL Motion by: Seconded by: Those in favor: Those against: Date: By:______________________ Its Mayor Attest: Its Clerk CERTIFICATION I, Elizabeth VanHoose, City Clerk of the City of Eagan, Dakota County, Minnesota, do hereby certify that the foregoing resolution was duly passed and adopted by the City Council of the City of Eagan, Dakota County, Minnesota, in a regular meeting thereof assembled this__ day of ______________, 20__. City Clerk Name of Donor Constance Miller $580 for a park bench at Thomas Lake Park Agenda Information Memo April 5, 2022 Eagan City Council Meeting CONSENT AGENDA J. Contract 21-28, Gun Club Road Trunk Sanitary Sewer Extension Action To Be Considered: Approve Change Order No. 1 for Contract 21-28 (Gun Club Road - Trunk Sanitary Sewer Extension) and authorize the Mayor and City Clerk to execute all related documents. Facts: Contract 21-28 provides for the following sanitary sewer system improvements: o Install approximately 350 feet of gravity 10-inch sanitary sewer and two manholes o Restore gravel road (Gun Club Road right-of-way) and disturbed area o Decommission adjacent sanitary sewer lift station and force main pipes installed in 2005 as a temporary solution for the Long Acres residential development On December 7, 2021, the contract was awarded to Minger Construction Co. Inc. for the base bid in the amount of $299,941.00. Change Order No. 1 provides for modification of a sanitary manhole structure and pipes to accommodate an alignment issue with an existing sewer stub and installation of a sanitary sewer cleanout on the service pipe to 4905 Biscayne Avenue. The change order provides for a cost addition of $13,432.40 (4.5% of original contract). The cost of the additional work is consistent with bid prices received for relevant bid items on this and other projects within the city and the region. The total additional cost of the revisions under the change order will be paid by City Utility funds. The change order has been reviewed by the Public Works Department and found to be in order for favorable Council action. Attachment (1) CJ-1 Change Order No. 1 Agenda Information Memo April 5, 2022 Eagan City Council Meeting CONSENT AGENDA K. Contract 22-02, Neighborhood Street Revitalization Action To Be Considered: Receive the bids for Contract 22-02 (Neighborhood Street Revitalization) and award a contract to OMG Midwest, Inc. dba Minnesota Paving & Materials for the base bid in the amount of $2,737,178.75 and authorize the Mayor and City Clerk to execute all related documents. Facts: Contract 22-02 provides for the street improvements as outlined and discussed in the respective Feasibility Reports for each of the following projects: o Ches Mar/ Ches Mar East/ Oak Chase Way/ Park Cliff Additions, Project No. 1441 o Johnny Cake Ridge Addition/ Covington Lane/ Brittany Additions/ Beacon Hill, Project No. 1443 as programmed for 2022 in the City’s 5-Year Capital Improvement Program (2022-2026) and authorized by the City Council on June 1, 2021. On March 31, 2022, four bid proposals were received (see attached summary). The low bid of $2,737,178.75 was 9.3% below the Engineer’s estimate of $3,018,000.00. All bids have been reviewed for compliance with the bid specifications and accuracy on unit price extensions and summations. The low bid of $2,737,178.75 from OMG Midwest, Inc. dba Minnesota Paving & Materials has been reviewed by Public Works staff and found to be in order for favorable Council action. Attachments (1) CK-1 Bid Summary BID SUMMARY NEIGHBORHOOD STREET REVITALIZATION CITY CONTRACT 22-02 CITY PROJECTS 1441 & 1443 Contractors Total Base Bid 1. OMG Midwest, Inc. dba Minnesota Paving & Materials $ 2,737,178.75 2. McNamara Contracting Inc. $ 2,867,336.25 3. Bituminous Roadways Inc. $ 2,870,406.80 4. Northwest Asphalt, Inc. $ 2,884,791.46 Contract Low Base Bid Engineer’s Estimate % Over/Under Eng Estimate 22-02 $2,737,178.75 $3,018,000.00 -9.3% Agenda Information Memo April 5, 2022 Eagan City Council Meeting CONSENT AGENDA L. Lot 1, Block 1 Yankee Doodle Professional Building Release of Storm Sewer Ponding & Well Field Agreements Action To Be Considered: Receive the petition to release storm sewer ponding and well field development agreements on Lot 1, Block 1 Yankee Doodle Professional Building (1519 Central Parkway) and schedule a public hearing to be held on May 3, 2022. Facts: On March 8, 2022, City staff received a petition from Steve Miller, representing MSP Commercial, requesting the release of two City agreements on Lot 1, Block 1 Yankee Doodle Professional Building (1519 Central Parkway): o Storm Sewer Ponding Agreement, Document No. 878525 o Well Field Development Agreement, Document No. 878526 both dated February 7, 1989, along with corresponding amendments. The property is located north of Yankee Doodle Road and west of Central Parkway in northwestern Eagan. The purpose of the request is to release City rights to construct storm water ponding and develop a well field (well drilling, associated piping and appurtenances) on this property, created by these two documents. The release of these agreements would clean up the title for said property. The City no longer has need to construct these types of facilities on the property. The existing agreements were originally dedicated with the original development of the property at no cost to the City. Notices for a public hearing will be published in the legal newspaper and sent to all potentially affected and/or interested parties for input prior to the public hearing. Attachments (2) CL-1 Location Map CL-2 Legal Description Graphics §¨¦35E !(43 !(28 $+26 $+31 $+31 !(30 ÕÇ13 ÕÇ55 ÕÇ149 DIFFLEY RD YANKEE DOODLE RD LEXINGTON AVEHWY 13I - 35EH WY 55 PILOT KNOB RDCORPORATE CENTER DR. CORPORATE CENTER CUR. TRAPP RD. EAG. INDUST. RD. EA G. IN D U ST. R D.WEST SERVICE RD.EAGANDALE CT.CENTERCT.EAGANDALEB L U E G E N TIAN ROAD C O MMERSDR.WATERS R D .LO N EO A KPKWY.APOLLO RD. ALDRIN DR.MIKE COLLINS DR.LUNARLN.GEMINI RD.NEIL ARMSTRONG BLVD.LONE OAKCIRPROMENADEAVE.CLUBVIEW DR.DENMARK AVE.DENMARK AVE.YANKEE PL.O'LEA RYLNTOWNCENT R E DRIVE DUCKWOOD DR.FEDERAL DR.CENTRALP A R K W A Y HIGH SITE DR. NORWEST DR. 81ST ST. W A S H NTNDR.FOUR OAKS RD.COACHMAN RD.MEADOWVIEW RD. ALEXANDER RD.TERMINAL DR.YANKEE DR.C O M A N C H E R D . S H A W N E E R D. SILVER BELL RD.BLACKHAWK RD.D E E R W OOD DR. NORTHVIEW PARK RD. WESCOTT RD. NORT H W OODPKWY.Lexington Ave (Co Rd 43)Blackhawk Rd.Deerwood Dr. Duckwood Dr. Northview Park Rd. Yankee Doodle Rd. (Co. Rd. 28) Town Center Dr.Braddock Tr.Federal DrivePilot Knob Road (Co. Rd. 31)Silver Bell Rd. N o rt h w oodPa r k w ay Crestridge Dr.Towerview Rd.Denmark Ave Lone Oak Rd. (Co. Rd. 26) MN HWY 55 MN HWY 149Location Map of ProposedEasement VacationLot 1, Block 1,Yankee Doodle Pr ofessional Building q Date: 3/23/2022 Location of ProposedEasement Vacation FIG 1. Document Path: L:\USERS\PUBWORKS\Engineer ing\Easement Vacation Graphics\Yankee Doodle Professional Bldg - Fig 1.mxd QUARRY ROADCENTRALPARKWAY(PUBLIC ROAD)PROPOSED VACATIONWATERMAIN/WELLEASEMENT PER DOC.NO. 878526CO05002GLAND SURVEYING, INC.CORNERSTONESuite #2001970 Northwestern AveStillwater, MN 55082Phone 651.275.8969Fax 651.275.8976dan@cssurvey.netPROJECT NO.CERTIFICATIONI hereby certify that this survey, plan orreport was prepared by me, or under mydirect supervision, and that I am a dulyLicensed Land Surveyor under the lawsof the State of MINNESOTA.DANIEL L. THURMESLicense No. 25718 Date:VACATION EXHIBITFOR: MSP COMMERCIALPROJECT LOCATION:1519 CENTRAL PARKWAYEAGAN, MINNESOTA0NORTH5003-15-2022VACATION DESCRIPTION:That portion of the Watermain/Well Easement asdescribed in Document No. 878526 embracedwithin Lot 1, Block 1, YANKEE DOODLEPROFESSIONAL BUILDING, according to therecorded plat thereof, Dakota County, Minnesota. Agenda Information Memo April 5, 2022 Eagan City Council Meeting CONSENT AGENDA M. Fox Forest Addition, Fox Forest Third Addition & Easement Document No. 955421 Easement Vacation Action To Be Considered: Receive the petition to vacate drainage and utility easements on Lots 1 and 3, Block 1 Fox Forest Addition, Lot 1, Block 1, Fox Forest Third Addition, and Easement Document No. 955421 and schedule a public hearing to be held on May 3, 2022. Facts: On March 10, 2022, City staff received a petition from Peter Ramstad, property owner of 1439 Lexington Way and 1435 Lexington Way, requesting the vacation of existing drainage and utility easements on the property west of Lexington Avenue and north of Diffley Road in central Eagan. The purpose of the request is to vacate existing public easements to facilitate the re-platting of the properties as the Fox Forest 4th Addition. The existing easements were originally dedicated as part of the existing plats at no cost to the City. The easement was recorded by separate document, also at no cost to the City. Drainage and utility easements will be dedicated along the reconfigured property lines through the recording of the new plat (Fox Forest 4th Addition) for the proposed new subdivision at no cost to the City. Notices for a public hearing will be published in the legal newspaper and sent to all potentially affected and/or interested parties for input prior to the public hearing. Attachments (2) CM-1 Location Map CM-2 Legal Description Graphics INVER GROVEHEIGHTS$+32 !(43 !(28 $+31 !(30 !(30 ÕÇ149 ÕÇ3 CLIFF RD DIFFLEY RD YANKEE DOODLE RD HWY 149LEXINGTON AVEPB RDMIKE COLLINS DROPPERMAN DR.DODD RD.PROMENADEAVE.DENMARK AVE.YANKEE PL.O'LEA RYLNTOWNCEN T R E DRIVE DUCKWOOD DR.FEDERAL DR.CENTRALP A NORWEST DR. 81ST ST. W A S H NTNDR.T H O MASLAKERD.WILD E R NESSRUNRD. OOD DR. NORTHVIEW PARK RD. WESCOTT RD.DODD RD.E L R ENERD.DODD RD. K WY. Cliff Road (Co. Rd. 32)Lexington Ave (Co Rd 43)Dodd Rd.Deerwood Dr. Wilderness Run Rd Duckwood Dr.El r ene RoadNorthview Park Rd. Yankee Doodle Rd. (Co. Rd. 28) E l r e n e R d . Town Center Dr. Th o masLakeRd.Braddock Tr.Federal DrivePilot Knob Road (Co. Rd. 31)Lexington Pt. Pkwy.Crestridge Dr.oadDenmark AveWescott Road MN HWY 149Location Map of Proposed Easement Vacation Lots 1 & 3, Block 1, Fox Forest Addition & Lot 1, Block 1, Fox Forest Third Addition Corrective Utility Easement Document #955421 q Date: 3/28/2022 Location of Proposed Easement Vacation FIG 1. Document Path: L:\USERS\PUBWORKS\Engineering\Easement Vacation Graphics\Fox Forest 1st & 3rd.mxd FIG 2 FIG 3 Agenda Information Memo April 5, 2022 Eagan City Council Meeting CONSENT AGENDA N. Project 1462, Diffley Road (CSAH 30) Street & Utility Improvements Action To Be Considered: Approve a Joint Powers Agreement between Dakota County Transportation Department (County Project 30-40) and the City of Eagan (City Project 1462) for Diffley Road (CSAH 30) street and utility improvements from east of Braddock Trail to State Highway 3 and authorize the Mayor and City Clerk to execute all related documents. Facts: The County desires to resurface Diffley Road (CSAH 30) from 360 feet east of Braddock Trail to State Highway 3, County Project 30-40. The City also has proposed to repair storm sewer, sanitary sewer and watermain structures along this section of Diffley Road (City Project 1462). The County and the City have included this project in their Capital Improvement Programs and would jointly participate in the costs of said highway resurfacing and storm sewer, sanitary sewer, and watermain structure repairs. The shared cost would be as follows: o The County would be solely responsible for the costs of milling and bituminous overlay and trail reclamation of Diffley Road from 360’ east of Braddock Trail to State Highway 3. o The County would pay 80% of the storm sewer repairs costs and the City will pay 20%. o The City would be responsible for all costs associated with the utility repairs to sanitary sewer system. o The City would be responsible for all costs associated with utility repairs to the watermain system. Like other cost sharing initiatives between the City and County, a Joint Powers Agreement has been prepared by the County for formal approval. $20,000 is estimated to be addressed by the Utilities Trunk Fund. The agreement has been reviewed by both agencies and their respective attorneys and found to be in order for favorable Council action. Attachments (1) CN-1 Joint Powers Agreement (Dakota County Contract No. C0035170) Dakota County Contract No. C0035170 JOINT POWERS AGREEMENT FOR MILLING, BITUMINOUS OVERLAY, DRAINAGE IMPROVEMENTS, AND CITY UTILITY REPAIRS BETWEEN THE COUNTY OF DAKOTA AND THE CITY OF EAGAN COUNTY PROJECT 30-40 CITY PROJECT 1462 SYNOPSIS: Dakota County Transportation Department and the City of Eagan agree to include the necessary storm sewer, sanitary sewer, and watermain repairs, in the resurfacing of County State Aid Highway 30 (Diffley Road) from 360 feet east of Braddock Trail to Trunk Highway 3, County Project 30-40, in Eagan, Dakota County. Contract No. C0035170 CP 30-40 March 17, 2022 2 THIS AGREEMENT, made and entered into by and between the County of Dakota, referred to in this Agreement as "the County"; and the City of Eagan, referred to in this Agreement as "the City". WHEREAS, under Minnesota Statutes Section 162.17, subdivision 1 and 471.59, subdivision 1, two governmental units may enter into an Agreement to cooperatively exercise any power common to the contracting parties, and one of the participating governmental units may exercise one of its powers on behalf of the other governmental units; and WHEREAS, the County desires to resurface County State Aid Highway (CSAH) 30 (Diffley Road) from 360 feet east of Braddock Trail to Trunk Highway 3 in Eagan, County Project 30-40 (the “Project”); and WHEREAS, the City desires to repair storm sewer, sanitary sewer and watermain structures along this section of CSAH 30; and WHEREAS, it is considered mutually desirable to include the necessary City storm sewer, sanitary sewer, and watermain structure repairs in County Project 30-40; and WHEREAS, the County and the City have included this Project in their Capital Improvement Programs and will jointly participate in the costs of said highway resurfacing and storm sewer, sanitary sewer, and watermain structure repairs. NOW, THEREFORE, it is agreed that the County and the City will share responsibilities and costs associated with County highway resurfacing, storm sewer repairs, sanitary sewer structure repairs, watermain structure repairs, and related activities as described in the following sections: 1. County highway resurfacing and trail reclamation. The County shall be solely responsible for the costs of the milling and bituminous overlay and trail reclamation of CSAH 30 from 360 feet east of Braddock Trail to Trunk Highway 3 in Eagan. 2. Storm Sewer Utility Repairs. The County and City shall share all costs associated with the repairs to storm sewer systems in the Project. The County shall pay for 80% of the storm sewer repair costs, and the City shall pay 20% of the storm sewer repair costs. The City shall be responsible for inspecting and approving this work. Further, the City shall be responsible for the maintenance of all such facilities after the completion of the Project. Contract No. C0035170 CP 30-40 March 17, 2022 3 3. Sanitary Sewer – City Utility Repairs. The City shall be responsible for all costs associated with the utility repairs to sanitary sewer systems in the Project. The City shall be responsible for inspecting and approving the utility work. Further, the City shall be responsible for the maintenance of all such facilities after the completion of the Project. 4. Watermain – City Utility Repairs. The City shall be responsible for all costs associated with the utility repairs to watermain systems in the Project. The City shall be responsible for inspecting and approving the utility work. Further, the City shall be responsible for the maintenance of all such facilities after the completion of the Project. 5. Plans, Specifications, and Award of Contract. The County shall prepare the complete milling and paving plans and specifications and contract documents for County Project 30-40 consistent with State Aid design standards and the Dakota County Transportation Plan. The City shall be responsible for inventorying and identifying necessary storm sewer, sanitary sewer, and watermain system repairs and preparing plans and technical specifications to be incorporated into the County’s plans and specifications. The repair plans shall be in accordance with City standards unless the City and County mutually agree on the alternative specifications. The City shall also be responsible for preparing the plans and technical specifications for the box culvert construction to be incorporated into the County’s plans and specifications. The County Board will award the contract for construction to the lowest responsible bidder in accordance with state law. 6. Payment. The County will administer the contract and act as the paying agent for all payments to the Contractor. Payments to the Contractor will be made as the project work progresses and when certified by the County Engineer. The County will bill the City for the City share of project costs. Upon presentation of an itemized claim by one agency to the other, the receiving agency shall reimburse the invoicing agency for its share of the costs incurred under this agreement within 35 days from the presentation of the claim. If any portion of an itemized claim is questioned by the receiving agency, the remainder of the claim shall be promptly paid, and accompanied by a written explanation of the amounts in question. Payment of any amounts in dispute will be made following good faith negotiation and documentation of actual costs incurred in carrying out the work. By submitting a written request from the Authorized Representative, the City agrees to pay their share of project costs in accordance with this Agreement. Contract No. C0035170 CP 30-40 March 17, 2022 4 7. Amendments. Any amendments to this Agreement will be effective only after approval by both governing bodies and execution of a written amendment document by duly authorized officials of each body. 8. Effective Dates. This Agreement will be effective upon execution by duly authorized officials of each governing body and shall continue in effect until all work to be carried out in accordance with this Agreement has been completed. In no event will this Agreement continue in effect after December 31, 2023, unless the parties mutually agree to an extension of the project term. 9. Change Orders and Supplemental Agreements. Any change orders or supplemental agreements that affect the Project cost participation must be approved by the Authorized Representatives of each Party prior to execution of work. Both Parties shall endeavor to provide timely approval of change orders and supplemental agreements so as not to delay construction operations. 10. Final completion. Final completion of a construction project must be approved by both the County and the City. 11. Pavement Maintenance. Upon acceptance of a project by the County and City, the County shall be responsible for all pavement maintenance within County right of way unless necessitated by a failure of a City utility system or installation of new facilities. 12. Subsequent Excavation. After completion of a project, and after expiration of the warranty period regarding repair, if excavation within the highway right of way is necessary to repair or install water, sewer, or other city utilities, the City shall apply for a permit from the County and shall be responsible to restore the excavated area and road surface to its original condition at the time of disturbance. If the City fails to have the highway properly restored, the County Engineer may have the work done and the City shall pay for the work within 30 days following receipt of a written claim by the County. 13. Rules and Regulations. The County and the City shall abide by Minnesota Department of Transportation standard specifications, rules and contract administration procedures, and State statutes as applicable to carrying out the work contemplated in this Agreement unless amended by the contract specifications. Contract No. C0035170 CP 30-40 March 17, 2022 5 14. Indemnification. The County agrees to defend, indemnify, and hold harmless the City against any and all claims, liability, loss, damage, or expense arising under the provisions of this Agreement and caused by or resulting from negligent acts or omissions of the County and/or those of County employees or agents. The City agrees to defend, indemnify, and hold harmless the County against any and all claims, liability, loss, damage, or expense arising under the provisions of this Agreement for which the City is responsible, including future operation and maintenance of facilities owned by the City and caused by or resulting from negligent acts or omissions of the City and/or those of City employees or agents. All parties to this agreement recognize that liability for any claims arising under this agreement are subject to the provisions of the Minnesota Municipal Tort Claims Law; Minnesota Statutes, Chapter 466. In the event of any claims or actions filed against either party, nothing in this Agreement shall be construed to allow a claimant to obtain separate judgments or separate liability caps from the individual parties. The County shall include the City as additional insured in the contract documents. 15. Employees of Parties. Any and all persons engaged in the work to be performed by the County shall not be considered employees of the City, for any purpose, including Worker’s Compensation, and any and all claims that may or might arise out of said employment context on behalf of said employees while so engaged. Any and all claims made by any third party as a consequence of any act or omission on the part of the County’s employees while so engaged on any of the work contemplated herein shall not be the obligation or responsibility of the City. Any and all persons engaged in the work to be performed by the City shall not be considered employees of the County for any purpose, including Worker’s Compensation, and any and all claims that may or might arise out of said employment context on behalf of said employee while so engaged. Any and all claims made by any third party as a consequence of any act or omissions of the part of the City’s employees while so engaged on any of the work contemplated herein shall not be the obligation or responsibility of the County. 16. Audits. Pursuant to Minnesota Statutes Sec 16 C. 05, Subd. 5, any books, records, documents, and accounting procedures and practices of the County and the City relevant to this Agreement are subject to examination by the County or the City and either the Legislative Auditor or the State Auditor as appropriate. The County and the City agree to maintain these records for a period of six years from the date of performance of all services covered under this Agreement. Contract No. C0035170 CP 30-40 March 17, 2022 6 17. Integration and Continuing Effect. The entire and integrated agreement of the Parties contained in this Agreement shall supersede all prior negotiations, representations or agreements between the City and the County regarding the Project; whether written or oral. All agreements for future maintenance or cost responsibilities shall survive and continue in full force and effect in accordance with the Dakota County Transportation Plan after completion of the construction provided for in this Agreement. 18. Authorized Representatives. The authorized representatives for the purpose of the administration of this Agreement are: Todd Howard (or successor) John Gorder (or successor) Assistant Dakota County Engineer City of Eagan Engineer 2800 160th St. West 3830 Pilot Knob Road Rosemount, MN 55068 Eagan, MN 55122 (952) 891-7906 651-675-5645 todd.howard@co.dakota.mn.us jgorder@cityofeagan.com All notices or communications required or permitted by this Agreement shall be either hand delivered or mailed by certified mail, return receipt requested, to the above addresses. Either party may change its address by written notice to the other party. Mailed notice shall be deemed complete two business days after the date of mailing. [SIGNATURE PAGE TO FOLLOW] IN WITNESS THEREOF, the parties have caused this Agreement to be executed by their duly authorized representative. CITY OF EAGAN RECOMMENDED FOR APPROVAL: By City Engineer (SEAL) By Date ---------------------------------------------------------------------------------------------------------------------------- COUNTY OF DAKOTA RECOMMENDED FOR APPROVAL: __________________________ By: __ County Engineer Physical Development Director Date: APPROVED AS TO FORM: /s/ Joseph Marek 3/17/22 Assistant County Attorney Date COUNTY BOARD RESOLUTION KS-22-155 No. 22-034 Date: January 18, 2022 Mike Maguire, Mayor Elizabeth VanHoose, City Clerk Agenda Information Memo April 5, 2022 Eagan City Council Meeting CONSENT AGENDA O. Project 1472, Lone Oak Road (CSAH 26) Trail Improvements Action To Be Considered: Approve a Joint Powers Agreement between Dakota County Transportation Department (County Project No. 26-69) and the City of Eagan (Project 1472) for Lone Oak Road (CSAH 26), Vince Trail to Pilot Knob Road, Trail Improvements and authorize the Mayor and City Clerk to execute all related documents. Facts: Dakota County Transportation Department and the City of Eagan have proposed to construct a multipurpose trail along Lone Oak Road (CSAH 26), from Vince Trail to Pilot Knob Road (CSAH 31). The County and the City have included this Project in their Capital Improvement Programs and would jointly participate in the construction costs for the trail and associated easement/ right-of-way, 85% of the costs paid by the County and 15% of the costs by the City ($18,000 estimated to be addressed by the Major Street Fund). Like other cost sharing initiatives between the City and County, a Joint Powers Agreement has been prepared by the County for formal approval. The agreement has been reviewed by both agencies and their respective attorneys and found to be in order for favorable Council action. Attachments (1) CO-1 Joint Powers Agreement (Dakota County Contract No. C0032515) Dakota County Contract No. C0032515 JOINT POWERS AGREEMENT FOR TRAIL CONSTRUCTION BETWEEN THE COUNTY OF DAKOTA AND THE CITY OF EAGAN COUNTY PROJECT 26-69 CITY PROJECT 1472 SYNOPSIS: Dakota County Transportation Department and the City of Eagan agree to construct a multipurpose trail along County State Aid Highway 26 (Lone Oak Road) from Vince Trail to County State Aid Highway 31 in Eagan, Dakota County. Contract No. C0032515 CP 26-69 March 31, 2022 2 THIS AGREEMENT, made and entered into by and between the County of Dakota, referred to in this Agreement as "the County"; and the City of Eagan, referred to in this Agreement as "the City". WHEREAS, under Minnesota Statutes Section 162.17, subdivision 1 and 471.59, subdivision 1, two governmental units may enter into an Agreement to cooperatively exercise any power common to the contracting parties, and one of the participating governmental units may exercise one of its powers on behalf of the other governmental units; and WHEREAS, the County and City desires to construct a new multipurpose trail segment on County State Aid Highway (CSAH) 26 (Lone Oak Road) from Vince Trail to CSAH 31 in Eagan, County Project 26-69 (the “Project”); and WHEREAS, the County and the City have included this Project in their Capital Improvement Programs and will jointly participate in the costs of said highway resurfacing, storm sewer, sanitary sewer, and watermain structure repairs. NOW, THEREFORE, it is agreed that the County and the City will share responsibilities and costs associated with County highway resurfacing, storm sewer structure repairs, sanitary sewer structure repairs, watermain structure repairs, and related activities as described in the following sections: 1. Engineering. Design engineering including all aspects of the Project (public involvement, agency involvement, preliminary/final design etc.), surveying, mapping, construction engineering, construction management, construction inspection and all related materials testing, including the cost of County and City staff time for these purposes, shall be split based on the County’s and City’s share of the final construction costs. 2. Construction Items. a. The costs for the construction the trail on CSAH 26 shall be shared in the amount of eighty-five percent (85%) by the County and fifteen percent (15%) by the City in accordance with County policy. Cost sharing includes all trail construction items; mitigation required by state and federal permits including accessibility requirements; storm sewer and other drainage facilities eligible for County State Aid funding based on contributing flows; replacement or restoration of fences, landscaping and driveways when affected by construction; replacement or adjustment of sanitary Contract No. C0032515 CP 26-69 March 31, 2022 3 sewer, water and storm sewer systems, if required due to construction; relocating or adjusting privately owned utilities when not performed at the expense of the utility; County’s share of water pollution best management practices, based on contributing flows, meeting National Urban Runoff Protection (NURP) standards; mitigation required for access modifications; replacement or adjustment of lighting, if required due to construction, and all other construction aspects outlined in the plan except for elements as called out under this Agreement or the current Dakota County Transportation Plan. b. The City and County are currently planning CP 26-67 for design and construction in a future year. In accordance with County policy, the County will be responsible for 100% of the costs to reconstruct or resurface this trail segment as part of CP 26-67 or any other future project. 3. Miscellaneous Elements. General maintenance will be handled in accordance with County policies included in the County’s current Transportation Plan. 4. City Utilities. Except as stated in the above sections of this Agreement, the City shall pay all other costs for sanitary sewer, water mains and appurtenances constructed as part of this Project. Further, the City shall be responsible for the maintenance of all such facilities after the completion of the Project. 5. Right-of-Way. The County will undertake all actions necessary to acquire all permanent and temporary highway right of way, including relocations, and will acquire all right of way for sidewalk and trail construction, wetland damage mitigation and banking, drainage and ponding, and water pollution control best management practices for the Project. Except as set forth below, the costs of acquiring highway right of way, including right of way for drainage inlets and outlets, shall be shared in the amount of 85% by the County and 15% by the City. The City shall convey to the County, at no cost, before construction of the Project begins, all necessary permanent highway and temporary easements, on forms approved by the County Attorney’s office, on all adjacent city- controlled real property for Project purposes. City shall convey rights to the County, at no cost, before construction of the Project begins, to all public easements and rights-of-way necessary for Project purposes. Upon completion of the Project, the ownership of the drainage and ponding easements and permanent right of way for City streets shall be transferred to the City. Any right of Contract No. C0032515 CP 26-69 March 31, 2022 4 way costs for new sanitary sewer, water mains and appurtenances, and aesthetic elements outside of the right of way needed for the highway improvements shall be the responsibility of the City. 6. Plans, Specifications, and Award of Contract. The County is the lead agency for design and construction administration of this Project, effective upon execution of this Agreement by both Parties. The City and the County shall approve the plans and specifications prior to advertising for bids. The County will advertise for bids for the construction of this Project in accordance with applicable state laws and will provide the City with an analysis of the bids received. The County Board will award the contract for construction to the lowest responsive and responsible bidder in accordance with state law. 7. Payment. The County will administer the contract and act as the paying agent for all payments to the Contractor. Payments to the Contractor will be made as the project work progresses and when certified by the County Engineer. The County will bill the City for the City share of project costs. Upon presentation of an itemized claim by one agency to the other, the receiving agency shall reimburse the invoicing agency for its share of the costs incurred under this agreement within 35 days from the presentation of the claim. If any portion of an itemized claim is questioned by the receiving agency, the remainder of the claim shall be promptly paid, and accompanied by a written explanation of the amounts in question. Payment of any amounts in dispute will be made following good faith negotiation and documentation of actual costs incurred in carrying out the work. By submitting a written request from the Authorized Representative, the City agrees to pay their share of project costs in accordance with this Agreement. 8. Amendments. Any amendments to this Agreement will be effective only after approval by both governing bodies and execution of a written amendment document by duly authorized officials of each body. 9. Effective Dates. This Agreement will be effective upon execution by duly authorized officials of each governing body and shall continue in effect until all work to be carried out in accordance with this Agreement has been completed. In no event will this Agreement continue in effect after December 31, 2023, except for maintenance items and clauses regarding cost participation in future projects, unless the parties mutually agree to an extension of the project term. Contract No. C0032515 CP 26-69 March 31, 2022 5 10. Change Orders and Supplemental Agreements. Any change orders or supplemental agreements that affect the Project cost participation must be approved by the Authorized Representatives of each Party prior to execution of work. Both Parties shall endeavor to provide timely approval of change orders and supplemental agreements so as not to delay construction operations. 11. Final completion. Final completion of a construction project must be approved by both the County and the City. 12. Pavement Maintenance. Upon acceptance of a project by the County and City, the County shall be responsible for all pavement maintenance within County right of way unless necessitated by a failure of a City utility system or installation of new facilities. 13. Subsequent Excavation. After completion of a project, and after expiration of the warranty period regarding repair, if excavation within the highway right of way is necessary to repair or install water, sewer, or other city utilities, the City shall apply for a permit from the County and shall be responsible to restore the excavated area and road surface to its original condition at the time of disturbance. If the City fails to have the highway properly restored, the County Engineer may have the work done and the City shall pay for the work within 30 days following receipt of a written claim by the County. 14. Rules and Regulations. The County and the City shall abide by Minnesota Department of Transportation standard specifications, rules and contract administration procedures, and State statutes as applicable to carrying out the work contemplated in this Agreement unless amended by the contract specifications. 15. Indemnification. The County agrees to defend, indemnify, and hold harmless the City against any and all claims, liability, loss, damage, or expense arising under the provisions of this Agreement and caused by or resulting from negligent acts or omissions of the County and/or those of County employees or agents. The City agrees to defend, indemnify, and hold harmless the County against any and all claims, liability, loss, damage, or expense arising under the provisions of this Agreement for which the City is responsible, including future operation and maintenance of facilities owned by the City and caused by or resulting from negligent acts or omissions of the City and/or those of City employees or agents. All parties to this agreement recognize that liability for any claims arising under this agreement are subject to the provisions of the Minnesota Municipal Contract No. C0032515 CP 26-69 March 31, 2022 6 Tort Claims Law; Minnesota Statutes, Chapter 466. In the event of any claims or actions filed against either party, nothing in this Agreement shall be construed to allow a claimant to obtain separate judgments or separate liability caps from the individual parties. The County shall include the City as additional insured in the contract documents. 16. Employees of Parties. Any and all persons engaged in the work to be performed by the County shall not be considered employees of the City, for any purpose, including Worker’s Compensation, and any and all claims that may or might arise out of said employment context on behalf of said employees while so engaged. Any and all claims made by any third party as a consequence of any act or omission on the part of the County’s employees while so engaged on any of the work contemplated herein shall not be the obligation or responsibility of the City. Any and all persons engaged in the work to be performed by the City shall not be considered employees of the County for any purpose, including Worker’s Compensation, and any and all claims that may or might arise out of said employment context on behalf of said employee while so engaged. Any and all claims made by any third party as a consequence of any act or omissions of the part of the City’s employees while so engaged on any of the work contemplated herein shall not be the obligation or responsibility of the County. 17. Audits. Pursuant to Minnesota Statutes Sec 16 C. 05, Subd. 5, any books, records, documents, and accounting procedures and practices of the County and the City relevant to this Agreement are subject to examination by the County or the City and either the Legislative Auditor or the State Auditor as appropriate. The County and the City agree to maintain these records for a period of six years from the date of performance of all services covered under this Agreement. 18. Integration and Continuing Effect. The entire and integrated agreement of the Parties contained in this Agreement shall supersede all prior negotiations, representations or agreements between the City and the County regarding the Project; whether written or oral. All agreements for future maintenance or cost responsibilities shall survive and continue in full force and effect in accordance with the Dakota County Transportation Plan after completion of the construction provided for in this Agreement. 19. Authorized Representatives. The authorized representatives for the purpose of the administration of this Agreement are: Contract No. C0032515 CP 26-69 March 31, 2022 7 Todd Howard (or successor) John Gorder (or successor) Assistant Dakota County Engineer City of Eagan Engineer 2800 160th St. West 3830 Pilot Knob Road Rosemount, MN 55068 Eagan, MN 55122 (952) 891-7906 651-675-5645 todd.howard@co.dakota.mn.us jgorder@cityofeagan.com All notices or communications required or permitted by this Agreement shall be either hand delivered or mailed by certified mail, return receipt requested, to the above addresses. Either party may change its address by written notice to the other party. Mailed notice shall be deemed complete two business days after the date of mailing. [SIGNATURE PAGE TO FOLLOW] IN WITNESS THEREOF, the parties have caused this Agreement to be executed by their duly authorized representative. CITY OF EAGAN RECOMMENDED FOR APPROVAL: By Public Works Director Mike Maguire, Mayor (SEAL) By Elizabeth VanHoose, City Clerk Date ---------------------------------------------------------------------------------------------------------------------------- COUNTY OF DAKOTA RECOMMENDED FOR APPROVAL: __________________________ By: __ County Engineer Physical Development Director Date: APPROVED AS TO FORM: Assistant County Attorney Date COUNTY BOARD RESOLUTION KS____________ No. _______ Date: Agenda Information Memo April 5, 2022 Eagan City Council Meeting CONSENT AGENDA P. Project 1477, Lone Oak Road (CSAH 26) Street Improvements & Corridor Study Action To Be Considered: Approve a Joint Powers Agreement between Dakota County Transportation Department and the City of Eagan for Lone Oak Road (CSAH 26) to do the following: 1) modify the existing 4-lane roadway with a lane reduction (3-lane roadway) from Pilot Knob Road (CSAH 31) to just west of Interstate 35E (County Project 26-66) and 2) prepare a corridor study and conceptual and feasibility preliminary engineering for Lone Oak Road from State Highway 13 to Pilot Knob Road (County Project 26-67) and authorize the Mayor and City Clerk to execute all related documents. Facts: To provide a safe and efficient transportation system, the County and the City have proposed to partner on the following: o County Project 26-66, Lone Oak Road (CSAH 26), Pilot Knob Road to I-35E, (Eagan Project 1477) for preliminary and final engineering, right-of-way, construction, maintenance, and cost participation. o County Project No. 26-67, Lone Oak Road (CSAH 26), TH 13 to Pilot Knob Road, (also Eagan Project 1477) for corridor study and conceptual and feasibility preliminary engineering and cost participation. On October 19, 2021, the Eagan City Council adopted a resolution in support of the projects included in the Dakota County Transportation Department’s CIP (2022- 2026). On November 16, 2021, the Eagan City Council adopted a resolution in support of amending the approved 5-year Public Works CIP (2022-2026), incorporating the expansion of the Lone Oak Road (CSAH 26) Corridor Study to include the study of the conversion from a 4-lane to a 3-lane roadway for the segment of Lone Oak Road from Pilot Knob Road to I-35E. The costs would be split with the County’s share at 85%, and the City’s share at 15% ($60,000 estimated to be addressed by the Major Street Fund). Like other cost sharing initiatives between the City and County, a Joint Powers Agreement has been prepared by the County for formal approval. The agreement has been reviewed by both agencies and their respective attorneys and found to be in order for favorable Council action. Attachments (1) CP-1 Joint Powers Agreement (Dakota County Contract No. C0035096) Dakota County Contract No.C0035096 JOINT POWERS AGREEMENT FOR PRELIMINARY & FINAL ENGINEERING, RIGHT-OF-WAY ACQUISITION, HIGHWAY CONSTRUCTION, AND MAINTENANCE AND COST PARTICIPATION BETWEEN THE COUNTY OF DAKOTA AND THE CITY OF EAGAN FOR DAKOTA COUNTY PROJECT NO. 26-66 and 26-67 CITY PROJECT NO. 1477 SYNOPSIS: Dakota County Transportation and the City of Eagan agree to participate collaborative on two projects in Eagan, Dakota County. County Project 26-66 will include preliminary and final design engineering for CSAH 26 (Lone Oak Road) to modify the existing roadway with a lane reduction with one lane in each direction from CSAH 31 (Pilot Knob Road) to just west of I-35E. County Project 26-67 will include a corridor study and conceptual and feasibility preliminary engineering for CSAH 26 from Trunk Highway 13 to CSAH 31. These projects will improve roadway operations, make safety improvements, enhance the transportation and multimodal network connectivity, and provide for future traffic levels. Contract No. C0035096 CP 11-27 January 2022 Page | 2 THIS AGREEMENT, made and entered into by and between the County of Dakota, referred to in this Agreement as the "County", and the City of Eagan, referred to in this Agreement as the "City", and witnesses the following: WHEREAS, under Minnesota Statutes Sections 162.17, subd. 1 and 471.59, subd. 1, two governmental units may enter into an Agreement to cooperatively exercise any power common to the contracting parties, and one of the participating governmental units may exercise one of its powers on behalf of the other governmental units; and WHEREAS, to provide a safe and efficient transportation system, the County and the City are partnering on County Projects, 26-66 (City of Eagan Project No. 1477) for preliminary and final engineering, right-of-way, construction, maintenance and cost participation; and WHEREAS, to provide a safe and efficient transportation system, the County and the City are partnering on County Project No. 26-67 (City of Eagan Project No. 1477) for corridor study and conceptual and feasibility preliminary engineering, and cost participation; and WHEREAS, the County and City have included this project in their Capital Improvement Programs and will jointly participate in the costs of said engineering design and construction; and WHEREAS, on October 19, 2021, the Eagan City Council adopted a resolution in support of the projects included in the Dakota County Transportation Department’s CIP (2022-2026) for construction in the years designated; and WHEREAS, on November 16, 2021, the Eagan City Council adopted a resolution in support that the City shall amend the currently approved 5-year Public Works CIP (2022-2026), incorporating the expansion of the Lone Oak Road (CSAH 26) Corridor Study to include the study of the conversion from a 4-lane to a 3-lane roadway for the segment of Lone Oak Road from Pilot Knob Road to I-35E; and WHEREAS, County and City staff recommends a joint powers agreement to define the engineering, right-of-way, construction, maintenance responsibilities and project cost participation. Contract No. C0035096 CP 11-27 January 2022 Page | 3 NOW, THEREFORE, it is agreed the County and City will share project responsibilities and jointly participate in the project costs associated with County Projects 26-66 and 26-67 (City of Eagan Project No. 1477) as described in the following sections: 1. Administration. The County is the lead agency for implementation, execution and completion of the project including administering the preliminary and final design contract, including right-of-way acquisition and construction administration and inspection. Subject to the requirements of Section 30 (Rules and Regulations) below, the County and the City shall each retain final decision-making authority within their respective areas of responsibility. 2. Cost Share. After application of all applicable cost sharing provisions of this Agreement and current adopted County Transportation Plan Cost Participation Polices F.1 through F.19, the County will participate in the projects as defined below. F.1 Cost Participation - Roadway The county will participate in engineering and construction costs for county highway and associated improvements as investment goal activity replacement and modernization cost share policy at 85% County share and 15% City share after deducting federal and state cost participation amounts, for the following cost-shared items, individually or in combination, for projects included in the adopted County CIP: 1. Highway construction. 2. Mitigation required by local, state and federal permits, including accessibility requirements. 3. Eligible storm sewer and other drainage facilities based on contributing flows meeting State Aid sharing factors. 4. Replacement or restoration of fences, landscaping, and driveways when affected by construction. 5. Centerline drainage culverts. 6. Existing traffic signals as part of a roadway project. 7. Replace or adjust sanitary sewer, water, and storm sewer systems, if required due to county highway construction. 8. Replace or adjust privately owned public utilities when utilities exist within privately held easements. Contract No. C0035096 CP 11-27 January 2022 Page | 4 9. Eligible water pollution control best management practice items based on the county's share of contributing flows and meeting National Pollution Discharge Elimination System (NPDES) standards such as outlet structures, sedimentation basins and ponds, and temporary erosion control. This includes recognition of the best management practices and systems necessary to meet all local, county, state or federal storm water treatment requirements. 10. Trail and sidewalks along county highways including pedestrian crossing improvements such as beacons, median refuges and bump outs, and overpasses or underpasses, including the Transportation share of greenway crossings, as deemed necessary by the county for safe accommodation of pedestrians and bicycles in the highway right-of-way. 11. Lighting of sidewalks and trails adjacent to county highways in marked school zones and pedestrian crossings in county highways right-of-way. 12. Transit infrastructure improvements on highways, including bus pullouts, bus shelter pads, and other pedestrian facilities determined necessary to support transit. F.2 Cost Participation - Aesthetic Participate in aesthetics up to three percent of the county share of highway construction costs (excluding right-of-way, bridges, ponds, and storm sewers) prior to application of federal, state, or jurisdictional transfer funds. The county share of aesthetic participation may not exceed the local cost share for aesthetics. Aesthetics may include landscaping, plantings, decorative pavements, surface treatments, or decorative fencing. The county will not participate in aesthetics on preservation or management projects. Aesthetic elements are subject to clear zone and sight line requirements, may not hinder normal maintenance operations, or degrade safety or operation of the highway, including trail or sidewalk facilities. The county will not participate in additional right-of-way necessary for only aesthetic enhancements. The local agency is responsible for maintenance of all aesthetic elements. Failure to maintain aesthetic elements may result in the local agency no longer being eligible for aesthetic funding participation. The county reserves the right to remove non-maintained aesthetic elements and recover costs from the local agency. Contract No. C0035096 CP 11-27 January 2022 Page | 5 F.3 Cost Participation - Right-of-Way The county will participate in the cost of right-of-way for county highway and associated improvements as 85% County share and 15% City share for existing highways where right-of-way is required for: 1. The construction of items described in F.1, (1-11), F.4 (Traffic Signals), F.8 (Multi- Use Trails and Sidewalk Maintenance) provided city land use decisions have supported right-of-way needs in the corridor. 2. The county's portion of storm sewer and other drainage facilities based on contributing flows meeting State Aid sharing factors. 3. The county portion of water pollution control best management practice items based on the county's share of the contributing flows and meeting NPDES standards. This includes recognition of the best management practices and systems necessary to meet all local, county, state or federal storm water treatment requirements. F.4 Cost Participation – Traffic Signals Traffic signals on county highways including construction costs for attached streetlights, interconnection, pre-emption, etc., will be eligible for the following county engineering and construction item participation after subtracting federal and/or state funds as follows: 1. Existing traffic signal replacement or modernization including operational revisions for independent intersection projects such as flashing yellow arrows and pedestrian indications up to the percentage of intersection approach legs under county jurisdiction. F.5 Cost Participation Involving Federal and State Funds Subtract from the county eligible project costs, funds received from regional federal solicitation, Trunk Highway Fund, Trunk Highway Jurisdictional Transfer Fund, or federal or state grants, with the balance of remaining costs divided according to applicable county policies. F.6 Cost Participation for Storm Sewer System Maintenance Share the cost of city maintenance of the following elements of county transportation facility storm water drainage systems: 1. Roadway catch basins and pipes connecting catch basins to mainline pipes are eligible for up to 80 percent county participation, or the county share of contributing flows, whichever is less. Contract No. C0035096 CP 11-27 January 2022 Page | 6 2. Mainline pipes at a minimum of 20 percent or the county’s share of contributing flows, whichever is greater. 3. Storm water treatment and mitigation facilities based on the county's share of contributing flows. 4. To be eligible for county participation, a system-wide maintenance agreement between the county and local agency will be required to identify system-wide storm water roles and cost responsibilities. These cost share agreements are for actual repair and replacement projects and not for routine maintenance activities such as cleaning. 5. To be eligible for county participation, storm sewer repair and maintenance projects must be included in the currently adopted CIP or be approved by the county prior to incurring costs. F.7 Multi-Use Trails and Sidewalk Maintenance Participate in pavement preservation, overlay, or reconstruction of trails and sidewalks along the county highway system up to 100 percent. The city is responsible for snow and ice removal. To be eligible for county participation in trails and sidewalks, a system-wide maintenance agreement between the county and local agency will be required to identify system-wide trail and sidewalk roles and cost responsibilities. F.8 Cost Participation – Local Roadway System The county may participate up to 85 percent, of the costs for construction of local roadways necessary to directly mitigate physical, safety or operational deficiencies on the county highway system. Actual participation amount shall be based on the quantifiable benefit to the county highway system, as determined by the county based on engineering study. Local roadway construction costs that will be considered include: 1. Costs associated with relocation and construction of portions of the local roadway system to provide for its continuity and operation at a level that approximates its condition prior to construction of a county highway project. 2. Costs associated with improvements necessary to adequately accommodate county highway traffic detoured onto a local roadway during county highway construction. 3. Costs to improve local roadways to adequately accommodate traffic turning from the county highway onto a local roadway due to the addition of turn lanes on the county highway. Contract No. C0035096 CP 11-27 January 2022 Page | 7 4. Costs directly associated with removal or consolidation of existing access to the county highway system. 5. Costs associated with construction of a local roadway that directly mitigates an existing county highway safety or operational issue or directly eliminates or significantly delays the need to expand the county highway system. F.9 Traffic Signal and Street Lighting Power Costs and Maintenance Responsibilities Participate in the maintenance and power costs for new and replacement traffic signals and standard streetlights as follows. Aesthetically enhanced and decorative streetlights are subject to Policy F.2. A. New and Replacement a. Installation (New and Replacement) Streetlights at intersections, marked pedestrian crossing locations and lighting along county highway trails within school zones with demonstrated safety benefit based on county evaluation – Participate up to 100 percent for power and maintenance costs. b. Street lighting at roundabouts – The county will be responsible for power costs and maintenance on county-county and state-county intersection roundabouts and the city will be responsible on city-county intersection roundabouts. c. The city is responsible for maintenance of streetlights and all costs for unmetered services. B. Existing a. Energy saving light retrofits - The county does not participate. Cities may elect to retrofit streetlights at their cost and by permit through the county. F.10 County Advanced Funding for City Cost Participation The county will consider advancing the local share of a project, consistent with adopted county cost participation policies, in the approved CIP’s by agreement with the city involved when all the following criteria are met: 1. The county determines there is a need on the county transportation system that should be addressed sooner than city funding allows. 2. The county has the available funds to pay the city cost share at the time the cost will be incurred. Contract No. C0035096 CP 11-27 January 2022 Page | 8 3. The city submits a request to the county explaining the reason(s) for the county to advance fund their share. 4. The plan for city repayment is defined in an agreement between the city and county. 5. County advance funding is limited to a maximum 3-year period. 3. Engineering. “Engineering Costs” shall be defined as design engineering costs, including public involvement, agency involvement, preliminary/final design, plans, specifications and proposal, surveying, mapping, consultant engineering, right-of-way mapping, construction engineering, construction management, construction inspection and all related materials testing, including the cost of County and City staff time for these purposes, (collectively, “Engineering Costs”). 4. Non-Project Costs. It is understood that for efficiency and cost effectiveness, the City may request elements exceeding the City’s Municipal State Aid street standards, such as City utilities and aesthetic improvements, be included in the projects. The City shall be responsible for 100% of the costs of City utilities not required due to construction, and 100% of all aesthetic elements that exceed the County share of aesthetic participation as defined by current adopted County Transportation Plan Cost Participation Policy F.2 – Aesthetic. 5. Municipal Construction Items. The costs for the design and reconstruction of improvements to any street under City jurisdiction, outside of the scope and construction limits for the projects, and any access or access improvements to local developments that are planned but not required by the projects, shall be the responsibility of the City. 6. Right-of-Way Acquisition. The County will undertake all actions necessary to acquire all permanent and temporary road right-of-way, all right of way for trails, drainage and ponds, and water pollution control best management practices necessary for the Project. The City shall convey to the County, at no cost, effective on the title and possession date of the Project, all necessary public easements and rights of way necessary for project purposes, on all adjacent City-controlled or dedicated real property for Project purposes including the right to grade within drainage, utility, and ponding easements and permanent right of way for City streets shall be owned by the City. Contract No. C0035096 CP 11-27 January 2022 Page | 9 7. Plans, Specifications and Award of Contract. The lead agency will prepare plans and specifications consistent with County and City design standards, State-Aid design standards and MnDOT standards and specifications. Concurrence with the plans and specifications is required prior to advertising for bids. Within 7 days of opening bids for the construction contract, the lead agency shall submit a copy of the low bid and an abstract of all bids together with the request for concurrence by the State in the award of the construction contract to the lowest responsible bidder. The lead agency may award the contract for construction to the lowest responsive and responsible bidder in accordance with state law. If a bid is not awarded, this Agreement shall terminate for the specific project that is not awarded, and all costs incurred as of the date of termination shall be apportioned in accordance with the terms of this Agreement. The contract construction shall be performed in accordance with State approved plans, specifications and special provisions which are made a part hereof by reference with the same force and effect as though fully set forth herein. 8. Construction Standards. All construction, including traffic control, shall be accomplished in accordance with applicable State Aid, County and City standards, specifications, and policies to the satisfaction of the County and City. The County and City reserves the right to inspect construction materials and methods as needed. 9. City Utilities. The City shall be responsible for the maintenance of all City utilities after the completion of the projects. 10. Project Cost Updates. The County will provide updated cost estimates to the City showing the County and City’s shares of Project costs annually at the time of Capital Improvement Program development. Updated cost estimates will also be provided by the County to the City at the following times: • Prior to approval of the appraised values for any necessary right-of-way acquisitions, • Upon completion of the 30% plans • Prior to advertising a construction contract, • After bid opening (prior to contract award), • During construction if total contract changes exceed $100,000, • Once per year following the construction season until the Project is complete. Contract No. C0035096 CP 11-27 January 2022 Page | 10 Project cost estimate updates include actual and estimated costs for engineering, right-of- way acquisition, utility relocation and construction. The Parties acknowledge that project cost estimates are subject to numerous variables causing the estimates to be subject to change and the updates are provided for informational purposes in good faith. Each agency is responsible for informing their respective council or board regarding project costs estimates. 11. Payment. The County will administer the contract and act as the paying agent for all payments to the consulting engineers. Payments will be made as the Project work progresses and when certified by the County Engineer. The County, in turn, will bill the City for their share of the Project costs. Upon presentation of an itemized claim by one agency to the other, the receiving agency shall reimburse the invoicing agency for its share of the costs incurred under this Agreement within 35 days from the presentation of the claim. If any portion of an itemized claim is questioned by the receiving agency, the remainder of the claim shall be promptly paid, and accompanied by a written explanation of the amounts in question. Payment of any amounts in dispute will be made following good faith negotiation and documentation of actual costs incurred in carrying out the work. 12. Change Orders and Supplemental Agreements. Any change orders or supplemental agreements that affect any of the projects’ cost participation must be approved by the Authorized Representative of each party prior to execution of work. Both Parties shall endeavor to provide timely approval of change orders and supplemental agreements so as not to delay construction operations. 13. Amendments. Any amendments to this Agreement will be effective only after approval by each governing body and execution of a written amendment document by duly authorized officials of each body. 14. Final Acceptance. Final acceptance of the projects must be approved by both Parties. The City requires a maintenance bond from the Contractor for the installation of City infrastructure (street and utilities) to be installed with the projects. The warranty period for materials and workmanship shall be two years from the date of final acceptance by the City. This requirement shall be included in the bidding documents for the projects. Contract No. C0035096 CP 11-27 January 2022 Page | 11 15. Pavement Maintenance. Upon acceptance of the projects, the City shall be responsible for all pavement maintenance within City right-of-way and the County shall be responsible for all pavement maintenance within County right-of-way unless necessitated by a failure of a municipal utility system or installation of new facilities. 16. Subsequent Excavation. After completion of the projects, and after expiration of the warranty period regarding repair, if excavation within the County right-of-way is necessary to repair or install water, sanitary sewer, or other city utilities, the City shall apply for a permit from the County and shall be responsible to restore the excavated area and road surface to substantially the condition at the time of disturbance. If the City employs its own contractor for the above described water, sewer or other utility repair or installation, the City shall hold the County harmless from any and all liability incurred due to the repair or installation of said water, sewer or other municipal utility including, but not limited to, the costs of repair as well as liability to third parties injured or damaged as a result of the work. If the City fails to have the highway properly restored, the County Engineer may have the work done and the City shall pay for the work within 35 days following receipt of a written claim by the County. 17. Rules and Regulations. The County and the City shall abide by Minnesota Department of Transportation standard specifications, rules, and contract administration procedures unless amended by the contract specifications. 18. Indemnification. Each Party agrees to defend, indemnify, and hold harmless the other Parties against any and all claims, liability, loss, damage, or expense arising under the provisions of this Agreement and caused by or resulting from negligent acts or omissions of the indemnifying Party and/or those of its employees or agents. All Parties to this Agreement recognize that liability for any claims arising under this Agreement are subject to the provisions of the Minnesota Municipal Tort Claims Law; Minnesota Statutes, Chapter 466. In the event of any claims or actions filed against either Party, nothing in this Agreement shall be construed to allow a claimant to obtain separate judgments or separate liability caps from the individual Parties. For purposes of determining total liability for damages, the City and County are considered a single governmental unit pursuant to Minn. Stat. § 471.59, subd. 1a. The City shall include the County as additional insured in the contract documents. Contract No. C0035096 CP 11-27 January 2022 Page | 12 19. Employees of Parties. Any and all persons engaged in the work to be performed by the County shall not be considered employees of the City, for any purpose, including Worker’s Compensation, and any and all claims that may or might arise out of said employment context on behalf of said employees while so engaged. Any and all claims made by any third party as a consequence of any act or omission on the part of said employees while so engaged on any of the work contemplated herein shall not be the obligation or responsibility of the City. Any and all persons engaged in the work to be performed by the City shall not be considered employees of the County for any purpose, including Worker’s Compensation, and any and all claims that may or might arise out of said employment context on behalf of said employee while so engaged. Any and all claims made by any third party as a consequence of any act or omissions of the part of the City’s employees while so engaged on any of the work contemplated herein shall not be the obligation or responsibility of the County. Nothing contained in this Agreement is intended or should be construed as creating or establishing the relationship of partners or joint ventures between the County and City, nor shall the County be considered or deemed an agent, representative, or employee of City and City shall not be deemed an agent, representative, or employee of the County. 20. Audits. Pursuant to Minnesota Statutes Section 16C.05, Subd. 5, any books, records, documents, and accounting procedures and practices of the County and the City relevant to this Agreement are subject to examination by the County or the City and either the Legislative Auditor or the State Auditor as appropriate. The County and the City agree to maintain these records for a period of six years from the date of performance of all services covered under this Agreement. Dakota County will be financially responsible for the cost of the audit. 21. Integration and Continuing Effect. The entire and integrated agreement of the Parties contained in this Agreement shall supersede all prior negotiations, representations or agreements between the City and the County regarding the Projects; whether written or oral. All agreements for future maintenance or cost responsibilities shall survive and continue in full force and effect after completion of the construction provided for in this Agreement together with each party’s indemnification obligations. Contract No. C0035096 CP 11-27 January 2022 Page | 13 22. Authorized Representatives. The authorized representatives for the purpose of the administration of this Agreement are: COUNTY OF DAKOTA CITY OF EAGAN Todd Howard (or successor) John Gorder (or successor) Dakota County Assistant Engineer Eagan City Engineer 14955 Galaxie Avenue 3rd floor 3830 Pilot Knob Road Apple Valley, MN 55124 Eagan, MN 55122 Office: (952) 891-7000 Office: (651) 675-5645 Todd.howard@co.dakota.mn.us JGorder@cityofeagan.com The Authorized Representative shall obtain authorization to implement or administer any provision of this Agreement from his or her respective governing body as required by the governing body’s policies and procedures. The parties shall promptly provide notice to each other when an Authorized Representative’s successor is appointed. The Authorized Representative’s successor shall thereafter be the Authorized Representative for purposes of this Agreement. All notices or communications required or permitted by this Agreement shall either be hand delivered or mailed by certified mail, return receipt requested, to the above addresses. Either party may change its address by written notice to the other party. Mailed notice shall be deemed completed two business days after the date of mailing. [SIGNATURE PAGE TO FOLLOW] Contract No. C0035096 CP 11-27 January 2022 Page | 14 IN WITNESS THEREOF, the parties have caused this Agreement to be executed by their duly authorized officials. CITY OF EAGAN RECOMMENDED FOR APPROVAL: __________________________ By_________________________ City Engineer John Gorder Mike Maguire, Mayor (SEAL) By_________________________ Elizabeth VanHoose, City Clerk Date_______________________ --------------------------------------------------------------------------------------------------------------------- DAKOTA COUNTY RECOMMENDED FOR APPROVAL: By Assistant County Engineer, Todd Howard Physical Development Director, Steven Mielke Date: APPROVED AS TO FORM: /s/ Jennifer L. Wolf 3/10/22 Assistant County Attorney Date Jennifer L. Wolf KS-22-106 COUNTY BOARD RESOLUTIONS No.1 Date: 22-034 January 11, 2022 No.2 Date: 22-043 January 18, 2022 Agenda Information Memo April 5, 2022 Eagan City Council Meeting CONSENT AGENDA T. Approve resolution delegating authority to the Director of Finance to make reimbursement declarations for certain proposed projects to be undertaken by the City. Action to be considered: To approve a resolution authorizing the delegation of authority to the Director of Finance to make reimbursement declaration for certain proposed projects to be undertaken by the City. Facts: IRS regulations generally require that the City declare an official intent to reimburse itself from tax exempt bond proceeds for construction costs (not engineering and planning costs) incurred prior to the issuance of the bonds to prevent cities from financing long‐past expenditures from newly‐issued bonds. Official intent can be expressed in any number of ways with City Council approval, or a designee from the City (typically the Finance Officer). The Declaration of the projects may occur without the issuance of bonds and no later than 60 days after the project expenditure is actually paid. The completed Official Intent Declaration will be on file for inspection in the Office of the Director of Finance. The City Council shall be advised from time to time as to the declarations made and on the desirability and timing of the reimbursement bonds relating to project expenditures. Attachments: CT‐1 Resolution CITY OF EAGAN RESOLUTION NO. 20- RESOLUTION RELATING TO FINANCING OF CERTAIN PROPOSED PROJECTS TO BE UNDERTAKEN BY THE CITY; ESTABLISHING COMPLIANCE WITH REIMBURSEMENT BOND REGULATIONS UNDER THE INTERNAL REVENUE CODE BE IT RESOLVED by the City Council of the City of Eagan, Minnesota (the “City”), as follows: 1. Recitals. (a) The Internal Revenue Service has issued Section 1.150-2 of the Income Tax Regulations (the “Regulations”) dealing with the issuance of bonds, all or a portion of the proceeds of which are to be used to reimburse the City for project expenditures made by the City prior to the date of issuance. (b) The Regulations generally require that the City make a declaration of its official intent to reimburse itself for such prior expenditures out of the proceeds of a subsequently issued series of bonds within 60 days after payment of the expenditures, that the bonds be issued and the reimbursement allocation be made from the proceeds of such bonds within the reimbursement period (as defined in the Regulations), and that the expenditures reimbursed be capital expenditures or costs of issuance of the bonds. (c) The City desires to comply with requirements of the Regulations with respect to certain projects hereinafter identified. 2. Official Intent Declaration. The Regulations, in the situations in which they apply, require the City to have made an official declaration of its intent (the “Official Intent Declaration” or the “Declaration”) to reimburse itself for previously paid project expenditures out of the proceeds of subsequently issued debt. The Council hereby authorizes the Director of Finance to make the City’s Official Intent Declarations. The following procedures shall be observed in making Official Intent Declarations: (a) Each Declaration shall made substantially in the form of the Exhibit A attached hereto and made a part of this Resolution. (b) The Director of Finance shall maintain a file in which all Declarations shall be kept. Upon completing a Declaration, the Director of Finance shall promptly (and in any event within 30 days) place (or cause to be placed) a copy of the Declaration in the file maintained for such purpose. Said file and each Declaration (up until the date upon which the reimbursement borrowing is made) shall be a part of the publicly available official books and records of the City, and shall be available for inspection by the general public during normal business hours. (c) The Director of Finance shall endeavor to not make Declarations in cases where the City will not ultimately be issuing reimbursement bonds to provide long term financing for project costs, and said official is hereby authorized and directed to consult with the City’s financial advisor and bond counsel concerning the requirements of the Regulations in general and their application in particular circumstances. (d) The Council shall be advised from time to time as to the Declarations made and on the desirability and timing of the issuance of reimbursement bonds relating to project expenditures for which Declarations have been filed, including recommendations on the timing of the issuance of such bonds so that the “Reimbursement Period Requirement” described in the Regulations can be met. 3. Reimbursement Allocations. The Director of Finance shall also be responsible for making the “reimbursement allocations” described in the Regulations, being generally the transfer of the appropriate amount of proceeds of the reimbursement bonds to reimburse the source of temporary financing used by the City to make payment of the original expenditures relating to the projects. Each reimbursement allocation shall be made within 30 days of the date of issuance of the reimbursement bonds, shall be evidenced by an entry on the official books and records of the City maintained for the reimbursement bonds and shall specifically identify the original expenditures being reimbursed. Adopted by the City Council of the City of Eagan, Minnesota, this 5th day of April 2022. CITY OF EAGAN ATTEST: By: _______________________________ Mike Maguire, Mayor Elizabeth VanHoose, City Clerk 3 EXHIBIT A Official Intent Declaration The undersigned, being the duly appointed and acting Director of Finance of the City of Eagan, Minnesota (the “City”), pursuant to and for purposes of compliance with Treasury Regulations, Section 1.150-2 (the “Regulations”), promulgated under the Internal Revenue Code of 1986, as amended, hereby states and certifies as follows: 1. The undersigned has been and is on the date hereof duly authorized by the City Council of the City to make and execute this Official Intent Declaration (the “Declaration”) for and on behalf of the City. 2. The City proposes to undertake certain projects (the “Projects”), which projects and the estimated costs thereof are generally described on Schedule I hereto, which is hereby incorporated herein and made a part hereof. 3. The City reasonably expects to reimburse the expenditures made for costs of the Projects out of the proceeds of debt in an estimated maximum aggregate principal amount of $____________ (the “Bonds”) after the date of payment of all or a portion of the costs of the Projects. All reimbursed expenditures shall be capital expenditures, a cost of issuance of the Bonds or other expenditures eligible for reimbursement under Section 1.150-2(d)(3) of the Regulations. 4. As of the date hereof, there are no City funds reserved, allocated on a long-term basis or otherwise set aside (or reasonably expected to be reserved, allocated on a long-term basis or otherwise set aside) to provide permanent financing for the expenditures related to the Projects, other than pursuant to the issuance of the Bonds. The statement of intent contained in this Declaration, therefore, is determined to be consistent with the City’s budgetary and financial circumstances as they exist or are reasonably foreseeable on the date hereof Dated:___________________, 20____. Director of Finance ____________________________ Schedule I Project Cost Agenda Information Memo April 5, 2022, Eagan City Council Meeting CONSENT AGENDA U. Set interest rate on special assessments for the next twelve months Action to be Considered: To set the interest rate for special assessments levied in the next twelve months at 4.0%. Facts: By policy, the interest rate for special assessments is set by the Council each year in April for projects to be assessed in the current year. The rate applies to assessments on public improvement projects, delinquent utility bills, and delinquent invoices for noxious weed‐cutting, board‐ups, and false alarm charges. The interest rate is to be between 1.5% and 2.0% over the current composite 10‐ year AAA municipal bond yield, rounded to the nearest .5%. The current composite 10‐year AAA municipal bond yield is 2.5%, putting the City interest rate range at 4.0% to 4.5%; therefore, the interest rate to be used on special assessments this year calculates to 4.0%. Last year, the special assessment rate was 3.0%. Attachments: None Agenda Information Memo April 5, 2022, Eagan City Council Meeting CONSENT AGENDA V. Direct preparation of an ordinance amendment to City Code Chapter 6 regarding a rental licensing program Action To Be Considered: To direct preparation of an ordinance amendment to City Code Chapter 6 regarding a rental licensing program. Facts: The City Council discussed Eagan’s rental housing and a potential rental licensing program at workshop meetings on November 9, 2021 and March 8, 2022. Eagan has a total of almost 30,000 residential housing units including single- family and multifamily development. Of total housing, 29 percent are rental units. Eagan was largely developed in the 1970s, 80s, and 90s, and most of the City’s housing stock is now 30 years or older and reaching the age when significant maintenance is necessary. Since the Great Recession, the number of single-unit rentals has increased substantially. Corporate and investor ownership of single-unit rentals is also increasing. Eagan has had a rental registration program since 2011. The rental registration program is free to property owners, does not require renewals, and does not require interior or exterior inspections. The purpose of the rental registration program is to collect contact information for rental owners and managers. Many Twin Cities suburban communities have rental licensing programs to preserve the housing stock and ensure safe housing. Rental licensing programs require regular inspections for basic maintenance and life-safety systems. Program costs are supported by licensing fees. The City Council directed staff to proceed with developing a rental licensing program. Attachments: (0) Agenda Information Memo April 5, 2022, Eagan City Council Meeting CONSENT AGENDA W. Variance – 3540 Federal Drive, Jonathan McCabe Action To Be Considered: To approve a one-year extension of the Variance approval of 10-feet to the required 40-foot structure setback from Duckwood Drive, upon property located at 3540 Federal Drive. Required Vote For Approval: Majority of Councilmembers present Facts: The City Council approved the Variance on April 16, 2019. City ordinance allows one year to implement a Variance. The Variance was previously extended, and the current request will extend the Variance approval another year to April 16, 2023. The applicant still intends to utilize the property, however, the COVID-19 pandemic has delayed the timeline for construction. The written extension request is attached. The applicant is proposing to construct a 4,000-square foot medical office building on the site, and the Variance allows a reduced building setback from 40 feet to 30 feet from Duckwood Drive. The site is a remnant parcel that resulted from the construction of the Duckwood Drive bridge over I-35E. The City declared the parcel surplus in 2018 and the applicant subsequently acquired it. Issues: None Attachments: (2) CW-1 Location Map CW-2 Extension Request F L IC K E R CR KOLSTADLNASHBURYROADTOWNCENTREDRIVEFEDERALDRIVE DREXEL CTDEN M A R KAVEB L A C K H A WKRDGCIRB O A R D W A L K BLACKHAWK RIDGE WAYB LACKHAW KCRESTVIEW LN DONALD CO U RTBLACKHAWK LAKE CTTOWN CENTRE DR C.S.A.H.NO.31(PILOTKNOBROAD)M U R P H Y PARKWAY CTK INGSWOODROADROCKY LNCRESTRIDGE DRDRESDEN CT DEERCLIFF DENMAR K T R A I L DENMARKAVEAS H B URY CT WIDGEONWAYBIRCHPONDRDB L ACK HAWKC O VE BLACKHAWKPTCUTTERS LANE LEMIEUX CIR DENMARK CTWESTCOTT R O A D NORWEST LAKEVI E WCURVEST.CHARLESPLACEKINGS WOODCT CRESTRIDGE LANE DENMARKAVEASHBURYPLACEWESTCOTT R O A DBLACKHAWKLAKEDRKRESTWOOD LNCOACHMANROADDREXEL CTSHERMAN COURTSURREYHEI GHTSD R IV E BLACKHAWKLAKEDRVIOLET LANE PARK P L C.S.A.H. NO. 31 (PILOT KNOB ROAD)ASHBURY ROAD HUNT DRIVE COACHMANROADFEDERALDRIVEDUCKWOOD DR M O U R N IN G D O V ECTKINGSW O O D LN ENGLERT RD L AKEVIEWTRAIL BLACKHAWKRIDGEPL DRESDEN WAYCOACH M A NROADL A N E PACIFICAVE FEDERAL DRIVEHAWK PL.BOARDWALKDEERCLIFF CTCOUNTY ROAD NO. 28 (YANKEE DOODLE ROAD)MERGANSER CTTANANGER C TC.S.A.H. NO. 31 (PILOT KNOB ROAD)DUCKWOOD DRFEDERAL DRIVEBRAUN CT LAKEDRCOACH M A NROADPINECREST CTW IN D C R E S T AV E QUARRY RD COUNTY ROAD NO.28 (YANKEE DOODLE ROAD)TIMBERSHORELANEBLACKHAW K LAKE PLBLACKH A W K R ID G E C T DENMARK AVEWA S HINGTONDRIVEWINDCREST COURTKOLSTAD ROADCROSSROADCT.DENMARK AVE81ST ST W CENTURY POINT B L ACKHAW K HILLS RD CRESTRI DG E C T KIN G S C R ESTLAKEVIEWCURVEASHBURYPL DE NMARK CTDENMARK AVEKINGSWOODROADBALTICAVEBlackhawkPark FishLakePark Quarry Park Park WindcrestPark Location Map 0 1,000500Feet ´ §¨¦35E §¨¦494 Cliff Rd Diffley Rd Yanke e Doodle Rd Lone Oak Rd Map Area Extent Project Name: Jo nathan McCabeRequest: VarianceCase No.: 16-VA-01-03-19 Subject Site 1 Pam Dudziak From: Jonathan McCabe <jonathan.c.mccabe@gmail.com> Sent: Monday, March 28, 2022 9:40 PM To: Pam Dudziak <pdudziak@cityofeagan.com>; Julie Strid <JStrid@cityofeagan.com> Subject: Re: 3540 Federal Dr ‐ Variance Expiration Good evening and thank you so much for your previous two messages, Ms. Dudziak. I'm so sorry that I was not available at the time of your call and have failed until now to get back to you. My colleagues and I were able to meet recently, and we would like to formally and politely request a one‐year extension of the Variance approval of 10‐feet to the required 40‐foot structure setback from Duckwood Drive, upon property located at 3540 Federal Drive. The circumstances surrounding the recent COVID‐19 pandemic and ongoing efforts to efficiently and effectively manage the original project timeline have been delayed. Thank you for your consideration. It has been and continues to be much appreciated. Jonathan Jonathan C. McCabe, DMD, MD Advanced Oral Surgery Cell: 507-327-9574 Email: jonathan.c.mccabe@gmail.com On Mon, Mar 28, 2022 at 12:32 PM Pam Dudziak <pdudziak@cityofeagan.com> wrote: Dr. McCabe, I am writing to follow up on the email below in regard to extending the Variance approval for this property. I also called about a week ago and left you a voice mail. To date, we have not received a response or your request to extend the Variance. If we do not hear from you before April 16, 2022, please be advised that the Variance will expire on that date. Sincerely, Pam Dudziak Pam Dudziak Planner 3830 Pilot Knob Rd | Eagan, MN 55122 Office: 651-675-5691 https://www.cityofeagan.com 2 From: Pam Dudziak Sent: Wednesday, March 2, 2022 3:02 PM To: jonathan.c.mccabe@gmail.com Cc: Julie Strid <JStrid@cityofeagan.com> Subject: 3540 Federal Dr ‐ Variance Expiration Dr McCabe, The setback Variance for this property expires April 16, 2022. If you still intend to develop the property and utilize the Variance application, please submit a written request for another extension. Please submit the extension request no later than March 25th, so we can place it on the April 5th City Council meeting agenda before the expiration. For your reference, I have attached your request from last year, along with the other City Council meeting information. Thank you and let me know if you have any questions. Kind Regards, Pam Dudziak Pam Dudziak Planner 3830 Pilot Knob Rd | Eagan, MN 55122 Office: 651-675-5691 https://www.cityofeagan.com Agenda Information Memo April 5, 2022, Eagan City Council Meeting CONSENT X. Final Planned Development – Sola Salons Action To Be Considered: To approve a Final Planned Development allowing a 9,445 square foot one‐story building intended for commercial use as a salon upon 1.3 acres located east of Nicolas Road between Cedar Grove Parkway and Eagan Outlets Parkway. Required Vote For Approval: Majority of Councilmembers present Facts: A Preliminary Planned Development was approved on January 5, 2021, with a term of three years. The final development plans have been reviewed by staff and are consistent with the preliminary approvals. All documents and agreements have been signed by the Applicant and are in order for approval at the City Council meeting on April 5, 2022. Attachments: (2) CX‐1 Location Map CX‐2 Agreements STATE T. H. N O. 1 3 SILVER BELL ROADC ED AR G R O VEPKW YJADE PTZIRCON LANE DIFFLEY SERVICE RD N SAPPHIRE LN RAHN ROADTACONITE TRAIL DIAMONDDRI VEMOONSTONEDRGOLD TRAIL AMETHYST LANEBLUESTONE LANE BERYL ROADGOLD TRAIL T U R Q U O IS E T R A I L GARNETLANE C.S.A.H. NO. 30 BEAVERDAMROADDURHAMC T NORTH TIMBERWOLFTRAILTESSERACT PLSTATETRUNKHIGHW AYNO.13CORAL LANE CALCITE DRBLUESTONE DRCHIPMUNK COURT NICOLS R O A D FLINT DRTOPAZ DRIVESOUTH RUBY C T LIMESTONE DRGLENFIELD C TOLD SIBLEY MEMORIAL HIGHWAYCINNABAR CT STATEHWY.NO.77(CEDARAVE.)KENNEBECDRIVEJADE LANERI V V L Y W A Y SIBL E Y CTWUTHERIN G HEI GHTS R D CED ARGROVEPKWYPUMICE POINT GARNET PTEMERALD LANE TIMBER WOLF CTSANDSTONEDRNORTHR U B Y CTSTATE T .H . NO . 77 (CEDAR AVE )LIMONITE LNRAHN ROADH E A THERDRALDER LANERAHNROADP U MIC E L NCAR N E L I A N L A N ENICOLSROAD C.S.A.H. NO. 30 (DIFFLEY ROAD)GARNETDRIVE DOLOM ITEDROLI VI NEDREAG ANO U T LE T S P K W Y F L INT LAN E JADE LANE LI MONITELANEJASPERDRMICA T R AIL SILVER BELL ROAD S E NECAROADCINNABAR D R SOUTH TIMBER W OLF TRAIL BERYL R O A D CARNELIAN LANE BURGUNDY DRPUMICE LANEPUMICE CTOPALDRIVE GOLD TRA I L A M B E R CT B E A VER DAMR O A DDIAMONDDRNICOLS ROADDIAMOND PTWILLOWWAYSILVER BELL RD CARNELIAN LANELAUREL CTO LD S IB LEYH IG H W AYOPAL P L . JADE LANE DEERHI LLST R AIL MICA TRAIL AMBERDRSUNRISE ROAD TURQUOISE TRAIL CEDA R G R O V E PK W Y EAGAN OUTLETS PK WYNICOLS RD/CEDAR GR OVE BLVD CedarPond Park WoodhavenPark Fort SnellingState Park BridgeviewPark Location Map 0 1,000500 Feet ´ §¨¦35E §¨¦494 Cliff Rd Diffley Rd Yankee Doodle Rd Lone Oak Rd Map Area Extent Project Name: Sola Salons Request: Final Planned DevelopmentFile No.: 19-FD-02-03-21 Subject Site I hereby certify that this plan, specification, or report wasprepared by me or under my direct supervision and that I ama duly Licensed Architect under the laws of the state ofMinnesota.Michael D. Knisely26926SignedPrinted NameDate Reg No.No. DescriptionDate01 Preliminary Development SubmittalPROJECT NO:DRAWN BY:CHECKED BY:A00120.40.02SOLA EAGAN4040 EAGAN OUTLETSPARKWAYEAGAN, MINNESOTA 55122ARCHITECTURAL SITEPLANMDKDRAWING INFORMATIONDRAWING TITLECOPYRIGHT 2020 DISTYLE DESIGN ARCHITECTS, P.C.KDF,DLK3410 WINNETKA AVE NORTH, STE. 103MINNEAPOLIS, MINNESOTA 55427[763] 591.099611/18/202011/18/2020S89°45'52"E30.80807.34807.89808.28808.52808.49809.28811.60812.84814.79816.87818.84821.23822.83823.94825.38826.45827.08827.39827.68828.52824.31817.07814.77812.75811.21809.56807.05808.39811.06812.44814.20817.04819.65826.71828.22827.46823.03819.15817.13814.62812.26811.19809.36809.23811.01812.65814.35816.92818.53820.49823.22822.23820.56819.15816.27814.64812.39810.72808.94810.80813.50816.18818.99827.76827.43827.54827.29818.02818.06818.55819.99820.21820.64821.72822.27828.69828.49828.24827.98827.76827.55827.17827.2290474807.97826.02822.98820.01817.36814.99812.90810.93809.68808.82808.38808.04805.68807.31807.86808.42808.47808.41808.01807.57828.22827.95827.61827.16826.61826.01825.59808.53828.07808.43808.51808.09827.83828.58828.24828.66805.07806.00806.34806.47806.95806.882" MPL2" TREE2" TREE2" TREE2" TREE2" TREE2" TREE2" TREE2" TREE2" TREE2" TREE18" PINE15" PINE16" CRAB16" CRAB14" CRAB18" PINE8" CRAB(PUBLIC)NICOLS ROAD (PUBLIC)33CEDAR GROVE PARKWAY (PUBLIC)TTHSS2142.61STRPLANTER BEDSPLANTER BEDS3' METAL FENCE1/2"FOUNDIRON1/2"FOUNDIRONFROCK LANDSCAPE101010GRASSGRASS37DRAINAGE AND UTILITY EASEMENT PER PARAGON ADDITION37LANDSCAPE EASEMENTNO. 1315LANDSCAPE EASEMENTNO. 1323RE=814.82IE=807.33FH15.1EAGANOUTLETS1/2"FOUNDIRONPARKWAYDRAINAGE AND UTILITY EASEMENT PER THEPLAT OF CEDAR GROVE PARKWAY 5TH ADDITIONEXISTING BUILDINGIRON FENCE W/ COLUMNSDRAINAGE AND UTILITY EASEMENT PER THE PLATOF CEDAR GROVE PARKWAY 5TH ADDITIONBENCHMARKTNH=811.3610101 0 10101010808810812814816818820822824826814812810816818820826824822828828826808806808DRAINAGE AND UTILITYEASEMENT PER THE PLATOF CEDAR GROVE PARKWAY5TH ADDITIONBITUMINOUSBITUMINOUSTRAILBITUMINOUSBITUMINOUS69RE=807.32IE=729.31 (SW)IE=796.22 (S)IE=790.82 (NE)IE=794.40 (N)80814.925.16.4R=256.67L=125.13Δ=27°55'54"N00°13'32"E 319.25S56°55'51"W 142.61R=33.00L=71.01Δ=123°17'43"N49°25'18"E25.48S00°13'32"W 315.0780IEH812.75812.7510A00219.00'63.00'(7) SPACES @9.00'19.00'6.00'154.00'30.00'108.00'(12) SPACES @ 9.00'9.00'81.00'(9) SPACES @9.00'9.00'63.00'(7) SPACES @ 9.00'3.00'19.00'19.00'81.00'(8) SPACES (1) AISLE @9.00'9.00'90.00'(10) SPACES @ 9.00'24.00'15.00'24.00'30.00'24.00'19.00'63.00'(7) SPACES @9.00'54.00'(6) SPACES @9.00'10.00'7.00'61.33'37.12'±FRONT YARD8.00'±19.00'24.00'72.00'REAR YARD114.54'SIDE YARD41.44'SIDE YARD18.00'23.00'12.00'15'x20' FREESTANDING ALUMPERGOLACONC STEPSBICYCLE PARKING(6 SPACES)PROPOSED TIETO EXST WALKHDCP PARKINGAISLE SIGNSSEESEE LANDSCAPE PLAN FORREPLACEMENT PLANTINGSAT REGRADED AREAPROPOSED SEGMENTALCONC BLOCKRETAINING WALLMAS REFUSEENCLOSURE, SEEPROPOSEDDRIVE APRON &AND CURB CUTPROPOSED TIETO EXST WALKPROPOSED MASONRY PIERS& ALUM FENCE TO MATCHEXST DECOR FENCE @SOUTHWEST PROP CORNERELECXFMREXST MASONRY PIERS& ALUM FENCEWALL-MTAREALIGHTWALL-MTAREALIGHTWALL-MTAREALIGHTAREALIGHTAREALIGHTAREALIGHTAREALIGHTCONCPATIO 1:20 RAMPPROPOSED 1-STORYMASONRY & STEELSALON STUDIOBUSINESSDNDNDNDNDN DN7A0021. BUILDING DIMENSIONS SHOWN ARE FROM FACE OF STUD/STRUCTUREAND AREA PERPENDICULAR TOR PARALLEL TO THE PROPERTY LINEN00° 13' 32"E.2. ELECTRONIC FILE WITH LAYOUT GEOMETRY FOR BUILDING & WALKSAVAILABLE UPON REQUEST FROM ARCHITECT.3. ANGLES ARE ASSUMED 90° AT LOCATIONS NOT LABELED.4. CURB DIMENSIONS ARE FROM CURB FACE UNLESS NOTEDOTHERWISE.5. COORDINATE WITH CIVIL DRAWINGS.6. UNLESS NOTED OTHERWISE, CURBS ARE DIMINISHED AT RAMPS.7. CONCRETE FLAT WORK AND PAVEMENT BASE SHALL BE PREPARED INACCORDANCE WITH THE GEOTECHNICAL INVESTIGATION.SITE AREA CALCULATIONSSITE AREA AREA TO PROPERTY BOUNDRY/ROW 58.219 SF 100%IMPERMEABLE SURFACES: BUILDINGS, WALKS, PARKING, REFUSE 37,291 SF 64%PERMEABLE SURFACES LANDSCAPE/GREEN SPACES 20,928 SF 36%PARKINGPARKING PROVIDED HANDICAP SPACES (19'x9') 2 ALL OTHER SPACES (19'x9') 64 TOTAL 66NSCALE: 1" = 20'13ARCHITECTURAL SITE PLANA001010'20' 40'SCALE: 1' = 1'-0"4SITE PLAN GENERAL NOTESA00101/2''1'' 2''SCALE: 1' = 1'-0"3SITE PLAN LEGENDA0010 1/2'' 1''2''SCALE: 1' = 1'-0"2SITE CALCULATIONSA0010 1/2'' 1''2''PRELIMINARY SITE PLANEXHIBIT B I hereby certify that this plan, specification, or report wasprepared by me or under my direct supervision and that I ama duly Licensed Architect under the laws of the state ofMinnesota.Michael D. Knisely26926SignedPrinted NameDate Reg No.No. DescriptionDate01 Preliminary Development SubmittalPROJECT NO:DRAWN BY:CHECKED BY:A50120.40.02SOLA EAGAN4040 EAGAN OUTLETS PARKWAYEAGAN, MINNESOTA 55122EXTERIOR ELEVATIONSMDKDRAWING INFORMATIONDRAWING TITLECOPYRIGHT 2020 DISTYLE DESIGN ARCHITECTS, P.C.KDF,DLK3410 WINNETKA AVE NORTH, STE. 103MINNEAPOLIS, MINNESOTA 55427[763] 591.099611/18/202011/18/2020B.1BAA.9T/O CONC (1ST)100'-0"T/O JOISTS115'-0"T/O PARAPET120'-0"T/O TOWER WALLS124'-0"T/O TOWER ROOF128'-8"1515152311416416112312107141621386151517.9122.1T/O CONC (1ST)100'-0"T/O JOISTS115'-0"T/O PARAPET120'-0"T/O TOWER WALLS124'-0"T/O TOWER ROOF128'-8"151523114164210752.121.9T/O CONC (1ST)100'-0"T/O JOISTS115'-0"T/O PARAPET120'-0"T/O TOWER WALLS124'-0"T/O TOWER ROOF128'-8"1515231141642107512917A.9ABB.1T/O CONC (1ST)100'-0"T/O CONC (1ST)100'-0"T/O JOISTS115'-0"T/O JOISTS115'-0"T/O PARAPET120'-0"T/O PARAPET120'-0"T/O TOWER WALLS124'-0"T/O TOWER WALLS124'-0"T/O TOWER ROOF128'-8"T/O TOWER ROOF128'-8"1515152311416416112312107141621315151. THIN BRICK VENEER, 1/3 COMMON BOND.COLOR: BELDEN BRICK “REGAL BLEND”2. THIN BRICK VENEER, 1/3 COMMON BOND.COLOR: BELDEN BRICK “DURANGO”3. THIN BRICK VENEER, SOLDIER COURSE.COLOR: BELDEN BRICK “COMMODORE”4. THIN BRICK VENEER, SOLDIER COURSE.COLOR: BELDEN BRICK “DURANGO”5. THIN BRICK VENEER PATTERN. COLOR: 2COURSES BELDEN BRICK “REGAL BLEND”, 1COURSE BELDEN BRICK “DURANGO”. DURANGOCOURSE STARTS BELOW STOREFRONT WINDOWSILLS.6. THIN BRICK VENEER ARCHWAY, STACK BOND.COLOR: BELDEN BRICK "DURANGO"7. ALUMINUM STOREFRONT WINDOW. COLOR:“DARK BRONZE” W/ CLEAR GLAZING8. ALUMINUM STOREFRONT DOOR WITHARCHED TRANSOM. COLOR: “DARK BRONZE” W/CLEAR GLAZING9. ALUMINUM STOREFRONT DOOR. COLOR:“DARK BRONZE” W/ CLEAR GLAZING.10. WALL MOUNTED GOOSENECK SCONCE. COLOR“BLACK”.11. EXTRUDED METAL CANOPY WITHDOWNLIGHTS. COLOR “BLACK”.12. CANVAS AWNING W/ AL TUBE FRAMESTRUCTURE WITH DOWNLIGHTS. COLOR “BLACK”.13. WALL SIGN 2’-0” TALL INDIVIDUAL REVERSE-LIT CHANNEL LETTERS.14. STANDING SEAM METAL ROOF. COLOR: " DARKBRONZE"15. PREFIN MTL COPING AND FASCIA. COLOR: "DARKBRONZE"16. DECORATIVE CORBELS. COLOR: "TAN"17. SPLIT FACE BLOCK @ EXPOSED FOUNDATION.COLOR: "BROWN"EXT FIN NOTESSCALE: 1/8" = 1'-0"5EAST ELEVATIONA50104'8' 16'SCALE: 1/8" = 1'-0"9SOUTH ELEVATIONA50104'8' 16'SCALE: 1/8" = 1'-0"10NORTH ELEVATIONA50104'8' 16'SCALE: 1/8" = 1'-0"13WEST ELEVATIONA50104'8' 16'XXEXHIBIT C CPRELIM. BUILDING ELEVATIONS & SIGNAGE SOLA EAGANEXTERIOR RENDERINGS11/10/20203410 WINNETKA AVE NORTHSUITE 103MINNEAPOLIS, MN 55427[763] 591.0996VIEW LOOKING SOUTHEAST FROM NICOLS ROADVIEW LOOKING NORTHWEST FROM PARKING LOT I hereby certify that this plan, specification, or report wasprepared by me or under my direct supervision and that I ama duly Licensed Architect under the laws of the state ofMinnesota.Michael D. Knisely26926SignedPrinted NameDateReg No.No. DescriptionDate0102Preliminary Development SubmittalPlan Review RevisionsPROJECT NO:DRAWN BY:CHECKED BY:A00320.40.02SOLA EAGAN4040 EAGAN OUTLETSPARKWAYEAGAN, MINNESOTA 55122LANDSCAPEPLANTING PLANMDKDRAWING INFORMATIONDRAWING TITLECOPYRIGHT 2020 DISTYLE DESIGN ARCHITECTS, P.C.KDF,DLK3410 WINNETKA AVE NORTH, STE. 103MINNEAPOLIS, MINNESOTA 55427[763] 591.099611/18/202012/02/2020([LVWLQJ&UDEDSSOH6SULQJ6QRZ([LVWLQJ3LQH$XVWULDQ([LVW&LW\/DQGVFDSLQJWRUHPDLQ&OHDQXSZHHGUHIUHVK%XII/LPHVWRQH3URSRVHG5HWDLQLQJ:DOO(QJLQHHULQJE\RWKHUV3URSRVHGIHQFHDERYHUHWDLQLQJZDOO'HVLJQE\RWKHUV%XVK+RQH\VXFNOH'ZDUI(OP3UDLULH([SHGLWLRQ6SUXFH%ODFN+LOOV%XVK+RQH\VXFNOH'ZDUI*LQJNR$XWXPQ*ROG3LQH6ZLVV6WRQH-XQLSHU$QGRUUD&RPSDFW&UDEDSSOH6SULQJ6QRZ'D\OLO\6WHOOD6XSUHPH*UDVV%OXH+HDYHQ/LWWOH%OXHVWHP5XGEHFNLD/LWWOH*ROG6WDU+\GUDQJHD6WUDZEHUU\6XQGDH6SLUHD)LUH/LJKW6HUYLFHEHUU\$XWXPQ%ULOOLDQFH&OXPS&RUDO%HOOV2EVLGLDQ*UDVV3UDLULH'URSVHHG0DSOH$XWXPQ%OD]H0DSOH$XWXPQ%OD]HGHQ%RXOHYDUG2DN6ZDPS:KLWH*LQJNR$XWXPQ*ROG6SUXFH%ODFN+LOOV3DUNLQJ/RW6FUHHQLQJ0DSOH6HLQQD*OHQ7UHHV3ODQWHGRQ$IILQLW\3URSHUW\WR5HSODFHWKH7UHHVWKDW1HHGWREH5HPRYHG7UHHV3ODQWHGRQ$IILQLW\3URSHUW\WR5HSODFHWKH7UHHVWKDW1HHGWREH5HPRYHG7UHHV3ODQWHGRQ$IILQLW\3URSHUW\WR5HSODFHWKH7UHHVWKDW1HHGWREH5HPRYHG7UHHV3ODQWHGRQ$IILQLW\3URSHUW\WR5HSODFHWKH7UHHVWKDW1HHGWREH5HPRYHG7UHH3ODFHPHQWVPD\QHHGWREHDGMXVWHGLQWKHILLHOGWRDYRLG&RQIOLFWVZLWKDQ\H[LVWLQJWUHHV7UHH3ODFHPHQWVPD\QHHGWREHDGMXVWHGLQWKHILLHOGWRDYRLG&RQIOLFWVZLWKDQ\H[LVWLQJWUHHV7UHH3ODFHPHQWVPD\QHHGWREHDGMXVWHGLQWKHILLHOGWRDYRLG&RQIOLFWVZLWKDQ\H[LVWLQJWUHHV7UHH3ODFHPHQWVPD\QHHGWREHDGMXVWHGLQWKHILLHOGWRDYRLG&RQIOLFWVZLWKDQ\H[LVWLQJWUHHVWKDWDUHWRUHPDLQWKDWDUHWRUHPDLQWKDWDUHWRUHPDLQWKDWDUHWRUHPDLQ*UDVV.DUO)RHUVWHU)HDWKHU5HHG'D\OLO\%DMD+RQH\ORFXVW6N\OLQH'D\OLO\%DMD+RQH\ORFXVW6N\OLQH*UDVV.DUO)RHUVWHU)HDWKHU5HHG%XVK+RQH\VXFNOH'ZDUI(OP3UDLULH([SHGLWLRQ'D\OLO\%DMD+RQH\ORFXVW6N\OLQH*UDVV.DUO)RHUVWHU)HDWKHU5HHG/LODF,YRU\6LON-XQLSHU*UH\2ZO &KRNHEHUU\$XWXPQ0DJLF&UDEDSSOH5R\DO5DLQGURSV'D\OLO\:LQHEHUU\&DQG\*UDVV.DUO)RHUVWHU)HDWKHU5HHGZLWKLQ6RG$UHDVDUHWRKDYHD 'LDPHWHUG0XOFK5LQJDWDGHSWKDQGQR0XOFKIWKH7UHHHWREH(GJHGZLWK&RPPHUFLDO*UDGH3RO\KH PX/FK IURP WKH VRG DUHDVDQGVFDSHDUHDE\2WKHUVDQGVFDSHDUHDE\2WKHUVDQGVFDSHDUHDE\2WKHUVDQGVFDSHDUHDE\2WKHUVQFHDW6:&RUQHURI6LWHQFHDW6:&RUQHURI6LWHQFHDW6:&RUQHURI6LWHQFHDW6:&RUQHURI6LWH%LUFK+HULWDJH5LYHU%LUFK+HULWDJH5LYHU1LQHEDUN&HQWHU*ORZ-XQLSHU*UH\2ZO*LQJNR$XWXPQ*ROG)ORZHU*UDVV*UDVV%OXH+HDYHQ/LWWOH%OXHVWHP6FKL]DFK\ULXPVFRSDULXP 0LQQEOXH$ &RQW*UDVV.DUO)RHUVWHU)HDWKHU5HHG&DODPDJURVWLV[DFXWLIORUD .DUO)RHUVWHU &RQW*UDVV3UDLULH'URSVHHG6SRUREROXVKHWHUROHSLV&RQW)ORZHU3HUHQQLDO&RUDO%HOOV2EVLGLDQ+HXFKHUD[ 2EVLVLGDQ &RQW'D\OLO\%DMD+HPHURFDOOLV %DMD 'D\OLO\6WHOOD6XSUHPH+HPHURFDOOLV 6WHOOD6XSUHPH 'D\OLO\:LQHEHUU\&DQG\+HPHURFDOOLV :LQHEHUU\&DQG\ &RQW5XGEHFNLD/LWWOH*ROG6WDU5XGEHFNLD /LWWOH*ROG6WDU &RQW6KUXE'HFLGXRXV%XVK+RQH\VXFNOH'ZDUI'LHUYLOODORQLFHUD&RQW&KRNHEHUU\$XWXPQ0DJLF$URQLDPHODQRFDUSD $XWXPQ0DJLF +\GUDQJHD6WUDZEHUU\6XQGDH+\GUDQJHDSDQLFXODWD 5HQVXQ 1LQHEDUN&HQWHU*ORZ3K\VRFDUSXVRSXOLIROLXV &HQWHU*ORZ 6SLUHD)LUH/LJKW6SLUDHD[ )LUH/LJKW 6KUXE(YHUJUHHQ&RQLIHU-XQLSHU$QGRUUD&RPSDFW-XQLSHUXVKRUL]RQWDOLV 3OXPRVD -XQLSHU*UH\2ZO-XQLSHUXVYLUJLQLDQD *UH\2ZO 7UHH'HFLGXRXV%LUFK+HULWDJH5LYHU%HWXODQLJUD &XOO\+HULWDJH &UDEDSSOH5R\DO5DLQGURSV0DOXV -)6.: &UDEDSSOH6SULQJ6QRZ0DOXV[ 6SULQJ6QRZ (OP3UDLULH([SHGLWLRQ8OPXVDPHULFDQD /HZLV &ODUN %%*LQJNR$XWXPQ*ROG*LQNJRELORED $XWXPQ*ROG +RQH\ORFXVW6N\OLQH*OHGLWVLDWULDFDQWKRVYDULQHUPLV 6N\FROH /LODF,YRU\6LON6\ULQJDUHWLFXODWD ,YRU\6LON /LQGHQ%RXOHYDUG7LOLD %RXOHYDUG 0DSOH$XWXPQ%OD]H$FHU[IUHHPDQLL -HIIHUVUHG 0DSOH6HLQQD*OHQ$FHU[IUHHPDQLL 6LHQQD %%2DN6ZDPS:KLWH4XHUFXVELFRORU6HUYLFHEHUU\$XWXPQ%ULOOLDQFH&OXPS$PHODQFKLHU[JUDQGLIORUD $XWXPQ%ULOOLDQFH %%7UHH(YHUJUHHQ3LQH6ZLVV3LQXVFHPEUD %%6SUXFH%ODFN+LOOV3LFHDJODXFD 'HQVDWD %%/HJHQG&RPPRQ1DPH%RWDQLFDO1DPH6L]H4W\&RQW&RQW&RQW&RQW&RQW&RQW&RQW&RQW%%%%%%%%%%%%%%%%%% 1257+&RPPHUFLDO*UDGH3RO\(GJLQJ3ODQWLQJ1RWHV 3ODQWLQJ1RWHV 3ODQWLQJ1RWHV 3ODQWLQJ1RWHV $OO7UHHV3ODQWHGZLWKLQ6RG$UHDVDUHWRKDYHD 'LDPHWHU6KUHGGHG+DUGZRRG0XOFK5LQJDWDGHSWKDQGQR0XOFK7RXFKLQJWKHWUXQNRIWKH7UHH$OO3ODQW%HGVDUHWREH(GJHGZLWK&RPPHUFLDO*UDGH3RO\(GJLQJ6HSHUDWLQJWKHPX/FKIURPWKHVRGDUHDV6HH*URXQGFRYHU3ODQIRU6RG/LPLWVDQG7\SHVRI0XOFKWREHXVHG6HH*URXQGFRYHU3ODQIRU6RG/LPLWVDQG7\SHVRI0XOFKWREHXVHG6HH*URXQGFRYHU3ODQIRU6RG/LPLWVDQG7\SHVRI0XOFKWREHXVHG6HH*URXQGFRYHU3ODQIRU6RG/LPLWVDQG7\SHVRI0XOFKWREHXVHG/LQGHQ%RXOHYDUG3URSRVHG)HQFHLQ&LW\/DQGVFDSHDUHDE\2WKHUV3URSRVHG)HQFHLQ&LW\/DQGVFDSHDUHDE\2WKHUV3URSRVHG)HQFHLQ&LW\/DQGVFDSHDUHDE\2WKHUV3URSRVHG)HQFHLQ&LW\/DQGVFDSHDUHDE\2WKHUVWR0DWFK([LVWLQJ)HQFHDW6:&RUQHURI6LWHWR0DWFK([LVWLQJ)HQFHDW6:&RUQHURI6LWHWR0DWFK([LVWLQJ)HQFHDW6:&RUQHURI6LWHWR0DWFK([LVWLQJ)HQFHDW6:&RUQHURI6LWH02EXHIBIT DPRELIMINARY LANDSCAPE PLAN I hereby certify that this plan, specification, or report wasprepared by me or under my direct supervision and that I ama duly Licensed Architect under the laws of the state ofMinnesota.Michael D. Knisely26926SignedPrinted NameDateReg No.No. DescriptionDate0102Preliminary Development SubmittalPlan Review RevisionsPROJECT NO:DRAWN BY:CHECKED BY:A00420.40.02SOLA EAGAN4040 EAGAN OUTLETSPARKWAYEAGAN, MINNESOTA 55122GROUNDCOVER-SOD/MULCH/EDGINGPLANMDKDRAWING INFORMATIONDRAWING TITLECOPYRIGHT 2020 DISTYLE DESIGN ARCHITECTS, P.C.KDF,DLK3410 WINNETKA AVE NORTH, STE. 103MINNEAPOLIS, MINNESOTA 55427[763] 591.099611/18/202012/02/2020*URXQGFRYHU6RG0XOFK(GJLQJ3ODQ*URXQGFRYHU6RG0XOFK(GJLQJ3ODQ*URXQGFRYHU6RG0XOFK(GJLQJ3ODQ*URXQGFRYHU6RG0XOFK(GJLQJ3ODQ6RG6KUHGGHG+DUGZRRG0XOFKDW'HSWKZLWK3UHHPHUJHQW+HUELFLGH )DEULF:HHG%DUULHU%XII/LPHVWRQHRYHU)DEULF:HHG%DUULHU&RPPHUFLDO*UDGH3RO\(GJLQJ1RWHV 1RWHV 1RWHV 1RWHV *RRGFOHDQ7RSVRLOWREHLQVWDOOHGLQDOO3ODQW%HG$UHDVWRZLWKLQRI7RSRI&XUE6LGHZDONVE\([FDYDWRU$OO3ODQW%HG$UHDVDUHWRKDYHD'HSWKRI&RPSRVWLQFRUSRUDWHGLQWRWKHVRLOVSULRUWR3ODQWLQJ'HSWKRI7RSVRLOWREHLQVWDOOHGE\H[FDYDWRUWRDOOSURSRVHG6RG$UHDVSHUSODQ$OO6RG$UHDVWREH*UDGHG6PRRWKDQGDOO6WRQHVODUJHUWKDQWREHUHPRYHG 1257+02 'DWH &RPPHQWV5HYLVLRQV'DWH [7KHVHGUDZLQJVDUHIRUFRQFHSWXDOXVHRQO\DQGDUHQRWLQWHQGHGIRUFRQVWUXFWLRQ)L[WXUHUXQVDQGTXDQWLWLHVVKRXOGEHYHULILHGSULRUWRRUGHU9DOXHVUHSUHVHQWHGDUHDQDSSUR[LPDWLRQJHQHUDWHGIURPPDQXIDFWXUHUVSKRWRPHWULFLQKRXVHRULQGHSHQGHQWODEWHVWVZLWKGDWDVXSSOLHGE\ODPSPDQXIDFWXUHUV6ROD(DJDQ01/6 'UDZQ%\ -RH)UH\6DOHV$JHQW .HYLQ.DVPLVNLH6FDOH /XPLQDLUH6FKHGXOH6\PERO4W\&DOFXODWLRQ6XPPDU\/DEHO&DOF7\SH8QLWV$YJ/DEHO$UUDQJHPHQW/XP/XPHQV//)'HVFULSWLRQ/XP:DWWV$UU:DWWV7RWDO:DWWV0D[0LQ$YJ0LQ$6,1*/( 6/0/('/6,/)7&5,,/ 0D[0LQ([WHULRU3DUNLQJ,OOXPLQDQFH)F ,QWHULRU3DUNLQJ,OOXPLQDQFH)F3DUNLQJORWDQGGULYHV%%$&.%$&. 6/0/('/6,/)7&5, &6,1*/( 6/0/(' /6,/&5,,/,OOXPLQDQFH)F6FDOH LQFK )W)/2253/$1 VTIW $ $ %%%%$$6 ( 03/ 3,1( 3,1( &5$% &5$% &5$% 3,1(&5$%1,&2/652$' 38%/,& &('$5 *5 29 (3 $5 .:$< 3 8 %/,& 7 7+ 6 6 7 5 3/$17(5%('6 3/$17(5%('6 0(7$/)(1&()2 ,5 2 1 )2 8 1 ',5 2 1 )52&./$1'6&$3( *5$66 *5$66 /$1'6&$3(($6(0(17 12 /$1'6&$3(($6(0(17 12 5 ( ,( ) + ($*$1 2 8 7 /(7 6 3 ,5 2 1 )(1 &(:&2 /8 0 1 6 %(1&+0$5. 71+ :0 "/ 1 ( 6 :5 / " 1 (6 : + $ $ %%%%$$'UJ,'/D\,'$$$$$ 0+ $ 0+ 0+ $ 0+ % 0+ & 0+ & PRELIMINARY SITE LIGHTING PLANEXHIBIT E Submitted by Luma Sales Associates, Inc. on Nov 13, 2020Kevin Kasmiskie Proj: Sola Type:C SLM-LED-09L-SIL-2-40-70CRI-IL Catalog # :Project : Date :Prepared By : LSI Industries Inc. 10000 Alliance Rd. Cincinnati, OH 45242 • www.lsi-industries.com (513) 372-3200 • ©2020 LSI Industries Inc. All Rights Reserved. Specifications subject to change without notice. Page 1/9 Rev. 09/09/20 SPEC.1023.A.0420 Slice Medium (SLM) Outdoor LED Area Light FEATURES & SPECIFICATIONS Construction •Rugged die-cast aluminum housing contains factory prewired driver and optical unit. Cast aluminum wiring access door located underneath. •Designed to mount to square poles. •Fixtures are finished with LSI’s DuraGrip® polyester powder coat finishing process. The DuraGrip finish withstands extreme weather changes without cracking or peeling. Other standard LSI finishes available. Consult factory. •Shipping weight: 30 lbs in carton. Optical System •State-of-the-Art one piece silicone optic sheet delivers industry leading optical control with an integrated gasket to provide IP66 rated sealed optical chamber in 1 component. •Proprietary silicone refractor optics provide exceptional coverage and uniformity in IES Types 2, 3, 5W, FT, FTA and AM. •Silicone optical material does not yellow or crack with age and provides a typical light transmittance of 93%. •Zero uplight. •Available in 5000K, 4000K, and 3000K color temperatures per ANSI C78.377. Also Available in Phosphor Converted Amber with Peak intensity at 610nm. •Minimum CRI of 70. •Integral louver (IL) and house-side shield (IH) options available for improved backlight control without sacrificing street side performance. See page 5 for more details. Electrical •High-performance driver features over- voltage, under-voltage, short-circuit and over temperature protection. •0-10V dimming (10% - 100%) standard. •Standard Universal Voltage (120-277 Vac) Input 50/60 Hz or optional High Voltage (347-480 Vac). •L80 Calculated Life: >100k Hours (See Lumen Maintenance on Page 3) •Total harmonic distortion: <20% •Operating temperature: -40°C to +50°C (-40°F to +122°F). 42L lumen package rated to +40ºC. •Power factor: >.90 •Input power stays constant over life. •Field replaceable 10kV surge protection device meets a minimum Category C Low operation (per ANSI/IEEE C62.41.2). •High-efficacy LEDs mounted to metal-core circuit board to maximize heat dissipation •Components are fully encased in potting material for moisture resistance. Driver complies with FCC standards. Driver and key electronic components can easily be accessed. Controls •Optional integral passive infrared Bluetooth™ motion and photocell sensor (see page 5 for more details). Fixtures operate independently and can be commissioned via iOS or Android configuration app. •LSI’s AirLink™ wireless control system options reduce energy and maintenance costs while optimizing light quality 24/7. (see page 5 for more details. Installation •A single fastener secures the hinged door, underneath the housing and provides quick & easy access to the electrical compartment. •Included terminal block accepts up to 12 ga. wire. •Utilizes LSI’s traditional 3” drill pattern B3 for easy fastening of LSI products. Warranty •LSI LED Fixtures carry a 5-year warranty. Listings •Listed to UL 1598 and UL 8750. •Meets Buy American Act requirements. •IDA compliant; with 3000K color temperature selection. •Title 24 Compliant; see local ordinance for qualification information. •Suitable for wet Locations. •IP66 rated Luminaire per IEC 60598. IP66 rated optical chamber. •3G rated for ANSI C136.31 high vibration applications •IP66 rated Luminaire per IEC 60598. IP66 rated optical chamber. •3G rated for ANSI C136.31 high vibration applicationsapplicationsare qualified. Specifications and dimensions subject to change without notice. OVERVIEW Lumen Package 9,000 - 42,000 Wattage Range 69 - 390 Efficacy Range (LPW)93 - 145 Weight lbs(kg)30 (13.6) QUICK LINKS Ordering Guide Performance Photometrics Dimensions ,KHUHE\FHUWLI\WKDWWKLVSODQVSHFLILFDWLRQRUUHSRUWZDVSUHSDUHGE\PHRUXQGHUP\GLUHFWVXSHUYLVLRQDQGWKDW,DPDGXO\/LFHQVHG$UFKLWHFWXQGHUWKHODZVRIWKHVWDWHRI0LQQHVRWD0LFKDHO'.QLVHO\ 6LJQHG3ULQWHG1DPH'DWH 5HJ1R1R 'HVFULSWLRQ'DWH3HUPLW$SSOLFDWLRQ %LGGLQJ6LWH5HYLVLRQV([WHULRUDQG6LWH5HYLVLRQV3HUPLW5HYLHZ5HVSRQFH5HYLHZ5HVSRQVH 352-(&712 '5$:1%< &+(&.('%< $62/$($*$1($*$1287/(763$5.:$<($*$10,11(627$$5&+,7(&785$/6,7(3/$1'5$:,1*,1)250$7,21'5$:,1*7,7/(&23<5,*+7',67</('(6,*1$5&+,7(&763&)/$*$9(1257+0,11($32/,60,11(627$>@ 0'..')6 ( 03/75((75((75((75((75((75((75((75((75((75((3,1(3,1(&5$%&5$%&5$%3,1(&5$% 38%/,& 1,&2/652$' 38%/,& &('$5*529(3$5.:$< 38%/,& 759&3 2))3523(57</,1(775&3+66639&75'7 3(53/$16 3/$17(5%('63/$17(5%('6 0(7$/)(1&()281',521)281',521)52&./$1'6&$3(*5$66*5$66'5$,1$*($1'87,/,7<($6(0(173(53$5$*21$'',7,21/$1'6&$3(($6(0(1712/$1'6&$3(($6(0(17125( ,( )(+($*$1287/(76)281',5213$5.:$<'5$,1$*($1'87,/,7<($6(0(173(57+(3/$72)&('$5*529(3$5.:$<7+$'',7,21(;,67,1*%8,/',1*,521)(1&(:&2/8016'5$,1$*($1'87,/,7<($6(0(173(57+(3/$72)&('$5*529(3$5.:$<7+$'',7,21%(1&+0$5.71+ '5$,1$*($1'87,/,7<($6(0(173(57+(3/$72)&('$5*529(3$5.:$<7+$'',7,21%,780,1286%,780,128675$,/%,780,1286%,780,1286 5( ,( 6: ,( 6 ,( 1( ,( 1 5( 3 ,( 3 5 / ¬ 1 ( 6 :5 / ¬ 1 (6 :39&678%,( 3 ,( ,( 1 ,( 6 6,(+$ 63$&(6# 63$&(6# 63$&(6# 6,'(<$5' 6,'(<$5' &/59,6,21$5($&/59,6,21$5($ 63$&(6# 63$&(6 $,6/(# 63$&(6# 5 5 5 7<3#3$5.,1*&251(565 5 5 5 [ )5((67$1',1*$/803(5*2/$&21&67(36%,&<&/(3$5.,1* 63$&(6 +'&33$5.,1*$,6/(6,*166((127(352326('6(*0(17$/&21&%/2&.5(7$,1,1*:$//0$65()86((1&/2685(6((352326(''5,9($3521 $1'&85%&87352326('7,(72(;67:$/.127((/(&;)05127( :$//07$5($/,*+7:$//07$5($/,*+7$5($/,*+7$5($/,*+7$5($/,*+73523/,1(352326(' +%/$&.$/80)(1&($/21*5(7:$//6((3,3(%2//$5'6:$//$77$&+('$:1,1*6$1'&$123,(65(029$%/(:$//$77$&+('$:1,1*6$1'&$123,(65(029$%/(:$//$77$&+('&$123<:$//$77$&+('$:1,1*6$1'&$123,(6:$//$77$&+('$:1,1*6$1'&$123,(6$5($/,*+763/$6+%/2&.$7'6/2&$7+,66,'(2)%/'*$5($/,*+76721(08/&+352326('675,3,1*&87$7'5,9(&21&3$7,2 5$03352326('6725<0$6215< 67((/6$/21678',2%86,1(66 6) )22735,17 '1'1'1'1'1 '1 5$03'1$$ %8,/',1*',0(16,2166+2:1$5()520)$&(2))281'$7,21:$//6758&785($1'$5($3(53(1',&8/$572$1'3$5$//(/727+(3523(57</,1(1 ( (/(&7521,&),/(:,7+/$<287*(20(75<)25%8,/',1* :$/.6$9$,/$%/(83215(48(67)520$5&+,7(&7 $1*/(6$5($6680(' $7/2&$7,216127/$%(/(' &85%',0(16,216$5()520&85%)$&(81/(66127('27+(5:,6( &225',1$7(:,7+&,9,/'5$:,1*6 81/(66127('27+(5:,6(&85%6$5(',0,1,6+('$75$036 &21&5(7()/$7:25.$1'3$9(0(17%$6(6+$//%(35(3$5(',1$&&25'$1&(:,7+$33529('5(&200(1'$7,216)5207+(*(27(&+1,&$/,19(67,*$7,21 6((/$1'6&$3(3/$1)255(3/$&(0(173/$17,1*6$75(*5$'('$5($2:1(57268%0,7)259(5,),&$7,21%<&,7<2)($*$1'2&80(1766+2:,1*$&&(66$*07:35232:1(5)25$&&(66$1'5(7$,1,1*:$//(1&2$&+0(172)1(::25. (;670$6215<3,(56 $/80)(1&(725(0$,1 352326('1257+($67&251(502180(176(($6,7($5($&$/&8/$7,2166,7()($785($5($ 2)*5266$5($ *5266$5($723523(57<%281'5<52: 6) 1(7$5($ (;&/8',1*($6(0(176 ,03(50($%/(685)$&(6 0$,1%8,/',1* 6) :$/.63$5.,1*5()86(6) 3(50($%/(685)$&(6 /$1'6&$3(*5((163$&(6 6) 3$5.,1*3$5.,1*3529,'(' +$1',&$3$&&(66,%/(63$&(6 [ $//27+(563$&(6 [ 727$/ 16&$/( $5&+,7(&785$/6,7(3/$1$ 6&$/( 6,7(3/$1*(1(5$/127(6$ 6&$/( 6,7(3/$1/(*(1'$ 6&$/( 6,7(&$/&8/$7,216$ 3HUPLW5HYLHZ5HVSRQVHEXHIBIT FFINAL SITE PLAN ,KHUHE\FHUWLI\WKDWWKLVSODQVSHFLILFDWLRQRUUHSRUWZDVSUHSDUHGE\PHRUXQGHUP\GLUHFWVXSHUYLVLRQDQGWKDW,DPDGXO\/LFHQVHG$UFKLWHFWXQGHUWKHODZVRIWKHVWDWHRI0LQQHVRWD0LFKDHO'.QLVHO\ 6LJQHG3ULQWHG1DPH'DWH 5HJ1R1R 'HVFULSWLRQ'DWH3HUPLW$SSOLFDWLRQ %LGGLQJ/DQGVFDSH5HYLVLRQ352-(&712 '5$:1%< &+(&.('%< $62/$($*$1($*$1287/(763$5.:$<($*$10,11(627$/$1'6&$3(3/$17,1*3/$1'5$:,1*,1)250$7,21'5$:,1*7,7/(&23<5,*+7',67</('(6,*1$5&+,7(&763&)/$*$9(1257+0,11($32/,60,11(627$>@ 0'..')/DQGVFDSH3ODQWLQJ3ODQ/DQGVFDSH3ODQWLQJ3ODQ/DQGVFDSH3ODQWLQJ3ODQ/DQGVFDSH3ODQWLQJ3ODQ([LVWLQJ&UDEDSSOH6SULQJ6QRZ([LVWLQJ3LQH$XVWULDQ([LVW&LW\/DQGVFDSLQJWRUHPDLQ&OHDQXSZHHGUHIUHVK%XII/LPHVWRQ3URSRVHG5HWDLQLQJ:DOO(QJLQHHULQJE\RWKHUV3URSRVHGIHQFHDERYHUHWDLQLQJZDOO'HVLJQE\RWKHUV(OP3UDLULH([SHGLWLRQ*LQJNR$XWXPQ*ROG&UDEDSSOH6SULQJ6QRZ*UDVV%OXH+HDYHQ/LWWOH%OXHVWHP5XGEHFNLD/LWWOH*ROG6WDU+\GUDQJHD6WUDZEHUU\6XQGDH6SLUHD)LUH/LJKW*UDVV3UDLULH'URSVHHG0DSOH$XWXPQ%OD]H0DSOH$XWXPQ%OD]H/LQGHQ%RXOHYDUG2DN6ZDPS:KLWH*LQJNR$XWXPQ*ROG6SUXFH%ODFN+LOOV3DUNLQJ/RW6FUHHQLQJ0DSOH6HLQQD*OHQ7UHHV3ODQWHGRQ$IILQLW\3URSHUW\WR5HSODFHWKH7UHHVWKDW1HHGWREH5HPRYHG7UHHV3ODQWHGRQ$IILQLW\3URSHUW\WR5HSODFHWKH7UHHVWKDW1HHGWREH5HPRYHG7UHHV3ODQWHGRQ$IILQLW\3URSHUW\WR5HSODFHWKH7UHHVWKDW1HHGWREH5HPRYHG7UHHV3ODQWHGRQ$IILQLW\3URSHUW\WR5HSODFHWKH7UHHVWKDW1HHGWREH5HPRYHG7UHH3ODFHPHQWVPD\QHHGWREHDGMXVWHGLQWKHILLHOGWRDYRLG&RQIOLFWVZLWKDQ\H[LVWLQJWUHHV7UHH3ODFHPHQWVPD\QHHGWREHDGMXVWHGLQWKHILLHOGWRDYRLG&RQIOLFWVZLWKDQ\H[LVWLQJWUHHV7UHH3ODFHPHQWVPD\QHHGWREHDGMXVWHGLQWKHILLHOGWRDYRLG&RQIOLFWVZLWKDQ\H[LVWLQJWUHHV7UHH3ODFHPHQWVPD\QHHGWREHDGMXVWHGLQWKHILLHOGWRDYRLG&RQIOLFWVZLWKDQ\H[LVWLQJWUHHVWKDWDUHWRUHPDLQWKDWDUHWRUHPDLQWKDWDUHWRUHPDLQWKDWDUHWRUHPDLQ*UDVV.DUO)RHUVWHU)HDWKHU5HHG'D\OLO\%DMD+RQH\ORFXVW6N\OLQH'D\OLO\%DMD+RQH\ORFXVW6N\OLQH*UDVV.DUO)RHUVWHU)HDWKHU5HHG%XVK+RQH\VXFNOH'ZDUI(OP3UDLULH([SHGLWLRQ&RPPHUFLDO*UDGH3RO\(GJLQJ3ODQWLQJ1RWHV 3ODQWLQJ1RWHV 3ODQWLQJ1RWHV 3ODQWLQJ1RWHV $OO7UHHV3ODQWHGZLWKLQ6RG$UHDVDUHWRKDYHD 'LDPHWHU6KUHGGHG+DUGZRRG0XOFK5LQJDWDGHSWKDQGQR0XOFK7RXFKLQJWKHWUXQNRIWKH7UHH$OO3ODQW%HGVDUHWREH(GJHGZLWK&RPPHUFLDO*UDGH3RO\(GJLQJ6HSHUDWLQJWKHPX/FKIURPWKHVRGDUHDV6HH*URXQGFRYHU3ODQIRU6RG/LPLWVDQG7\SHVRI0XOFKWREHXVHG6HH*URXQGFRYHU3ODQIRU6RG/LPLWVDQG7\SHVRI0XOFKWREHXVHG6HH*URXQGFRYHU3ODQIRU6RG/LPLWVDQG7\SHVRI0XOFKWREHXVHG6HH*URXQGFRYHU3ODQIRU6RG/LPLWVDQG7\SHVRI0XOFKWREHXVHG 1257+3URSRVHG)HQFHLQ&LW\/DQGVFDSHDUHDE\2WKHUV3URSRVHG)HQFHLQ&LW\/DQGVFDSHDUHDE\2WKHUV3URSRVHG)HQFHLQ&LW\/DQGVFDSHDUHDE\2WKHUV3URSRVHG)HQFHLQ&LW\/DQGVFDSHDUHDE\2WKHUVWR0DWFK([LVWLQJ)HQFHDW6:&RUQHURI6LWHWR0DWFK([LVWLQJ)HQFHDW6:&RUQHURI6LWHWR0DWFK([LVWLQJ)HQFHDW6:&RUQHURI6LWHWR0DWFK([LVWLQJ)HQFHDW6:&RUQHURI6LWH1LQHEDUN&HQWHU*ORZ1LQHEDUN&HQWHU*ORZ%XVK+RQH\VXFNOH'ZDUI$UERUYLWDH7HFKQLWR*UDVV.DUO)RHUVWHU)HDWKHU5HHG7UHH3ODQWLQJ6SHFLILFDWLRQV% % 'LJDKROHDSSUR[LPDWHO\IRRWZLGHUWKDQWKHURRWEDOODQGQRGHHSHUWKDQWKHZLGHVWSDUWRIWKHURRWEDOOIRUEDOOHGDQGEXUODSSHGWUHHV3ODFHWKHURRWEDOORIWKHWUHHVRWKDWWKHURRWFROODUIODUHLVWRDERYHH[VWLQJVRLOJUDGH2QFHLQWKHKROHFXWDQGUHPRYHDOOWZLQHUHPRYHWKHWRSRIWKHEXUODSDQGWKHZLUHEDVNHW7DNHH[WUDFDUHLQSODFLQJWKHWUHHDVWRQRWGLVWXUEWKHURRWEDOO%DFNILOORIWKHKROHZLWKH[LVWLQJVRLOVPL[HGZLWKVRPHFRPSRVWRUSHDW:DWHUWKRURXJKO\)LQLVKEDFNILOOLQJPDNLQJVXUHWKDWWKHWUHHUHPDLQVYHUWLFDO%DFNILOOXSWRWKHURRWFROODUIODUH'RQRWFRYHUWKHURRWFROODUIODUH,QVWDOODIRRWPXOFKULQJDURXQGWKHWUHHDWDGHSWK0XOFKVKRXOGQRWFRPHLQFRQWDFWZLWKWKHWUXQNRIWKHWUHH6WDNLQJVKRXOGQRWEHQHFHVVDU\XQOHVVWKHWUHHWLSVGXULQJVWURQJZLQGV*UDVV.DUO)RHUVWHU)HDWKHU5HHG'D\OLO\6WHOOD6XSUHPH-XQLSHU$QGRUUD&RPSDFW)RUV\WKLD*ROG7LGH-XQLSHU0HGRUD'D\OLO\%DMD+RQH\ORFXVW6N\OLQH-XQLSHU*UH\2ZO/LODF,YRU\6LON7UHH&KRNHEHUU\$XWXPQ0DJLF2DN3UDLULH6WDWXUH*UDVVHV 3HUHQQLDOV*UDVV%OXH+HDYHQ/LWWOH%OXHVWHP6FKL]DFK\ULXPVFRSDULXP 0LQQEOXH$ *UDVV.DUO)RHUVWHU)HDWKHU5HHG&DODPDJURVWLV[DFXWLIORUD .DUO)RHUVW'D\OLO\%DMD+HPHURFDOOLV %DMD 'D\OLO\6WHOOD6XSUHPH+HPHURFDOOLV 6WHOOD6XSUHPH 6KUXE'HFLGXRXV&KRNHEHUU\$XWXPQ0DJLF$URQLDPHODQRFDUSD $XWXPQ0DJLF )RUV\WKLD*ROG7LGH)RUV\WKLD &RXUWDVRO 1LQHEDUN&HQWHU*ORZ3K\VRFDUSXVRSXOLIROLXV &HQWHU*ORZ 6SLUHD)LUH/LJKW6SLUDHD[ )LUH/LJKW 6KUXE(YHUJUHHQ-XQLSHU$QGRUUD&RPSDFW-XQLSHUXVKRUL]RQWDOLV 3OXPRVD -XQLSHU*UH\2ZO-XQLSHUXVYLUJLQLDQD *UH\2ZO 7UHH'HFLGXRXV (YHUJUHHQ&UDEDSSOH6SULQJ6QRZ0DOXV[ 6SULQJ6QRZ *LQJNR$XWXPQ*ROG*LQNJRELORED $XWXPQ*ROG +RQH\ORFXVW6N\OLQH*OHGLWVLDWULDFDQWKRVYDULQHUPLV 6N\FRO/LODF,YRU\6LON6\ULQJDUHWLFXODWD ,YRU\6LON /LQGHQ%RXOHYDUG7LOLD %RXOHYDUG 0DSOH$XWXPQ%OD]H$FHU[IUHHPDQLL -HIIHUVUHG -XQLSHU0HGRUD-XQLSHUXVVFRSXORUXP 0HGRUD 3LQH$XVWULDQ3LQXVQLJUD6SUXFH%ODFN+LOOV3LFHDJODXFD 'HQVDWD 2DN3UDLULH6WDWXUH4XHUFXV[ELPXQGRUXP 0LGZHVW 2DN6ZDPS:KLWH4XHUFXVELFRORU(OP3UDLULH([SHGLWLRQ8OPXVDPHULFDQD /HZLV &ODUN $FHU[IUHHPDQLL 6LHQQD 0DSOH6LHQQD*OHQ*UDVV3UDLULH'URSVHHG6SRUREROXVKHWHUROHSLV%XVK+RQH\VXFNOH'ZDUI'LHUYLOODORQLFHUD$UERUYLWDH7HFKQLWR7KXMDRFFLGHQWDOLV %DLOMRKQ 5XGEHFNLD/LWWOH*ROGVWDU5XGEHFNLD /LWWOH*ROG6WDU +\GUDQJHD6WUDZEHUU\6XQGDH+\GUDQJHDSDQLFXODWD 5HQVXQ *UDVVHV 3HUHQQLDOV*UDVV%OXH+HDYHQ/LWWOH%OXHVWHP6FKL]DFK\ULXPVFRSDULXP 0LQQEOXH$ &RQW*UDVV.DUO)RHUVWHU)HDWKHU5HHG&DODPDJURVWLV[DFXWLIORUD .DUO)RHUVWHU 'D\OLO\%DMD+HPHURFDOOLV %DMD 'D\OLO\6WHOOD6XSUHPH+HPHURFDOOLV 6WHOOD6XSUHPH 6KUXE'HFLGXRXV&KRNHEHUU\$XWXPQ0DJLF$URQLDPHODQRFDUSD $XWXPQ0DJLF )RUV\WKLD*ROG7LGH)RUV\WKLD &RXUWDVRO &RQW1LQHEDUN&HQWHU*ORZ3K\VRFDUSXVRSXOLIROLXV &HQWHU*ORZ 6SLUHD)LUH/LJKW6SLUDHD[ )LUH/LJKW 6KUXE(YHUJUHHQ-XQLSHU$QGRUUD&RPSDFW-XQLSHUXVKRUL]RQWDOLV 3OXPRVD -XQLSHU*UH\2ZO-XQLSHUXVYLUJLQLDQD *UH\2ZO 7UHH'HFLGXRXV (YHUJUHHQ&UDEDSSOH6SULQJ6QRZ0DOXV[ 6SULQJ6QRZ *LQJNR$XWXPQ*ROG*LQNJRELORED $XWXPQ*ROG +RQH\ORFXVW6N\OLQH*OHGLWVLDWULDFDQWKRVYDULQHUPLV 6N\FROH /LODF,YRU\6LON6\ULQJDUHWLFXODWD ,YRU\6LON /LQGHQ%RXOHYDUG7LOLD %RXOHYDUG 0DSOH$XWXPQ%OD]H$FHU[IUHHPDQLL -HIIHUVUHG %%-XQLSHU0HGRUD-XQLSHUXVVFRSXORUXP 0HGRUD 3LQH$XVWULDQ3LQXVQLJUD %%6SUXFH%ODFN+LOOV3LFHDJODXFD 'HQVDWD /HJHQG&RPPRQ1DPH%RWDQLFDO1DPH6L]H4W\&RQW&RQW&RQW&RQW&RQW&RQW&RQW&RQW&RQW%%%%%%%%%%%%%%%%2DN3UDLULH6WDWXUH4XHUFXV[ELPXQGRUXP 0LGZHVW 2DN6ZDPS:KLWH4XHUFXVELFRORU%%(OP3UDLULH([SHGLWLRQ8OPXVDPHULFDQD /HZLV &ODUN $FHU[IUHHPDQLL 6LHQQD 0DSOH6LHQQD*OHQ*UDVV3UDLULH'URSVHHG6SRUREROXVKHWHUROHSLV&RQW%XVK+RQH\VXFNOH'ZDUI'LHUYLOODORQLFHUD %% %% %%$UERUYLWDH7HFKQLWR7KXMDRFFLGHQWDOLV %DLOMRKQ &RQW&RQW5XGEHFNLD/LWWOH*ROGVWDU5XGEHFNLD /LWWOH*ROG6WDU +\GUDQJHD6WUDZEHUU\6XQGDH+\GUDQJHDSDQLFXODWD 5HQVXQ EXHIBIT GFINAL LANDSCAPE PLAN ,KHUHE\FHUWLI\WKDWWKLVSODQVSHFLILFDWLRQRUUHSRUWZDVSUHSDUHGE\PHRUXQGHUP\GLUHFWVXSHUYLVLRQDQGWKDW,DPDGXO\/LFHQVHG$UFKLWHFWXQGHUWKHODZVRIWKHVWDWHRI0LQQHVRWD0LFKDHO'.QLVHO\ 6LJQHG3ULQWHG1DPH'DWH 5HJ1R1R 'HVFULSWLRQ'DWH3HUPLW$SSOLFDWLRQ %LGGLQJ/DQGVFDSH5HYLVLRQ352-(&712 '5$:1%< &+(&.('%< $62/$($*$1($*$1287/(763$5.:$<($*$10,11(627$*5281'&29(562'08/&+('*,1*3/$1'5$:,1*,1)250$7,21'5$:,1*7,7/(&23<5,*+7',67</('(6,*1$5&+,7(&763&)/$*$9(1257+0,11($32/,60,11(627$>@ 0'..') 1257+6RG6KUHGGHG+DUGZRRG0XOFKDW'HSWKZLWK3UHHPHUJHQW+HUELFLGH )DEULF:HHG%DUULHU%XII/LPHVWRQHRYHU)DEULF:HHG%DUULHU&RPPHUFLDO*UDGH3RO\(GJLQJ1RWHV 1RWHV 1RWHV 1RWHV *RRGFOHDQ7RSVRLOWREHLQVWDOOHGLQDOO3ODQW%HG$UHDVWRZLWKLQRI7RSRI&XUE6LGHZDONVE\([FDYDWRU$OO3ODQW%HG$UHDVDUHWRKDYHD'HSWKRI&RPSRVWLQFRUSRUDWHGLQWRWKHVRLOVSULRUWR3ODQWLQJ'HSWKRI7RSVRLOWREHLQVWDOOHGE\H[FDYDWRUWRDOOSURSRVHG6RG$UHDVSHUSODQ$OO6RG$UHDVWREH*UDGHG6PRRWKDQGDOO6WRQHVODUJHUWKDQWREHUHPRYHG$OO1HZ6RGWREH,QVWDOOHGWRWKH*UDGLQJ/LPLWV,QFOXGLQJWKH'LVWXUEHG$UHDVRQWKH$GMDFHQW3URSHUW\6HH*UDGLQJ3ODQIRU([WHQWRI/LPLWV,UULJDWLRQ1RWHV ,UULJDWLRQ1RWHV ,UULJDWLRQ1RWHV ,UULJDWLRQ1RWHV $OOVRGDUHDVDUHWREHFRYHUHGE\VSUD\LUULJDWLRQ$OOSODQWEHGVDUHWREHFRYHUHGZLWKGULSLUULJDWLRQ3ODQWEHGDUHDVDUHWREH]RQHGVHSDUDWHO\IURPVRGWXUIDUHDV+XQWHU3URVSUD\VDQG5RWRUVDUHWREHXVHGIRUWKHVRGWXUIDUHDV+XQWHU&RQWUROOHUWREHLQVWDOOHGLQVLGHWKHEXLOGLQJPHFKDQLFDOURRP+XQWHUZLUHOHVVUDLQVHQVRUWRLQVWDOOHG*URXQGFRYHU6RG0XOFK(GJLQJ3ODQ*URXQGFRYHU6RG0XOFK(GJLQJ3ODQ*URXQGFRYHU6RG0XOFK(GJLQJ3ODQ*URXQGFRYHU6RG0XOFK(GJLQJ3ODQ ,KHUHE\FHUWLI\WKDWWKLVSODQVSHFLILFDWLRQRUUHSRUWZDVSUHSDUHGE\PHRUXQGHUP\GLUHFWVXSHUYLVLRQDQGWKDW,DPDGXO\/LFHQVHG$UFKLWHFWXQGHUWKHODZVRIWKHVWDWHRI0LQQHVRWD0LFKDHO'.QLVHO\ 6LJQHG3ULQWHG1DPH'DWH 5HJ1R1R 'HVFULSWLRQ'DWH3HUPLW$SSOLFDWLRQ %LGGLQJ([WHULRUDQG6LWH5HYLVLRQV3HUPLW5HYLHZ5HVSRQFH5HYLHZ5HVSRQVH352-(&712 '5$:1%< &+(&.('%< $62/$($*$1($*$1287/(763$5.:$<($*$10,11(627$(;7(5,25(/(9$7,216'5$:,1*,1)250$7,21'5$:,1*7,7/(&23<5,*+7',67</('(6,*1$5&+,7(&763&)/$*$9(1257+0,11($32/,60,11(627$>@ 0'..')))$$ ('&%72&21&)/5 72&21&)/5 72&08#-2,6732&.(76 72&08#-2,6732&.(76 7<37<30,16+*&)25*/$=,1*7+,6(/(9$7,21 72&21&)/5 72&21&)/5 72&08#-2,6732&.(76 72&08#-2,6732&.(76 0,16+*&)25*/$=,1*7+,6(/(9$7,21 72&21&)/5 72&21&)/5 72&08#-2,6732&.(76 72&08#-2,6732&.(76 0,16+*&)25*/$=,1*7+,6(/(9$7,21 $ $))%&'(72&21&)/5 72&21&)/5 72&08#-2,6732&.(76 72&08#-2,6732&.(76 0,16+*&)25*/$=,1*7+,6(/(9$7,21 %5,&. %5,&. %5,&.,162/',(5&2856( %5,&.,162/',(5&2856( &08$&&(173$77(51 3529,'((-$7,16,'(&251(562)%5,&.352-(&7,216(('(7$,/21$ $/80,1806725()5217:,1'2:&2/25 ³'$5.%521=(´:&/($5*/$=,1* $/80,1806725()5217'225:,7+$5&+('75$1620&2/25 ³'$5.%521=(´:&/($5*/$=,1* $/80,1806725()5217'225 )5$0(&2/25 ³'$5.%521=(´:&/($5*/$=,1* :$//02817('*226(1(&.6&21&(&2/25³%/$&.´ 0(7$/&$123<:,7+'2:1/,*+76&2/25³'$5.%521=(´ &$19$6$:1,1*:$/78%()5$0(6758&785(:,7+'2:1/,*+76&2/25³%/$&.´ :$//6,*1¶´7$//,1',9,'8$/5(9(56(/,7&+$11(//(77(56 &0852&.)$&(&08:,7+$&&(176 35(),107/&23,1*$1')$6&,$&2/25 '$5.%521=( 60227+)$&(&08%(+,1'&$19$6$:1,1*602817('21&080$7&+52&.)$&(&2/25 $/80,1806725()5217:,1'2:&2/25 ³'$5.%521=(´:,168/63$1'5(/*/$=,1*$7$5&+ :$//02817('$5($/,*+7&2/25 %/$&. 3$&.$*('+9$&578 20,77(' 20,77(' *$23(1)$&(''2:163287 :,7+/,1(5720$7&+(;7(5,25&2/25 $1'&2//(&725+($' 7+58:$//29(5)/2:6&833(5 )5((67$1',1*$/803(5*2/$ *$*877(5 23(1)$&(''2:163287 :/,1(5720$7&+(;7&2/25 $*5$'(:$/.3529,'( ¦60227+)$&(25%851,6+('&080$7&+$&&(1725),(/'$65(48,5('¦0$;,080&2856(62)%5,&.%(/2:*5$'(:$/.¦67(33(')281'$7,21$65(48,5('12(;326('67$1'$5'&08LocationArea %WallAreaArea %WallAreaEastElevationϯ͕ϬϬϯ^& KǀĞƌĂůůǁͬŽƉŝŶŐWƌŝŵĂƌLJ&ŝŶŝƐŚĞƐ^ĞĐŽŶĚĂƌLJ&ŝŶŝƐŚĞƐKǀĞƌĂůů;ǁͬŽŽƉŝŶŐƐͿ Ϯ͕ϴϲϳ^& ϭϬϬй Dd>ŽƉŝŶŐϭϯϲ^&ϱй ŽĨŽǀĞƌĂůůǁͬĐŽƉŝŶŐƌŝĐŬĂŶĚ'ůĂƐƐϭ͕ϴϭϲ^& ϲϯй ĂŶǀĂƐǁŶŝŶŐƐϬ^&Ϭй KǀĞƌďƌŝĐŬDhϭ͕Ϭϱϭ^& ϯϳй DĞƚĂůĐĂŶŽƉŝĞƐϯ^&фϭй KǀĞƌďƌŝĐŬWestElevationϮ͕ϳϲϵ^& KǀĞƌĂůůǁͬŽƉŝŶŐWƌŝŵĂƌLJ&ŝŶŝƐŚĞƐ^ĞĐŽŶĚĂƌLJ&ŝŶŝƐŚĞƐKǀĞƌĂůů;ǁͬŽŽƉŝŶŐƐͿ Ϯ͕ϲϯϯ^& ϭϬϬй Dd>ŽƉŝŶŐϭϯϲ^&ϱй ŽĨŽǀĞƌĂůůǁͬĐŽƉŝŶŐƌŝĐŬĂŶĚ'ůĂƐƐϭ͕ϳϯϳ^& ϲϲй ĂŶǀĂƐǁŶŝŶŐƐ ϰϰϭ^&Ϭй KǀĞƌďƌŝĐŬDhϴϵϲ^& ϯϰй DĞƚĂůĐĂŶŽƉŝĞƐϯ^&фϭй KǀĞƌďƌŝĐŬNorthElevationϭ͕ϮϮϬ^& KǀĞƌĂůůǁͬŽƉŝŶŐWƌŝŵĂƌLJ&ŝŶŝƐŚĞƐ^ĞĐŽŶĚĂƌLJ&ŝŶŝƐŚĞƐKǀĞƌĂůů;ǁͬŽŽƉŝŶŐƐͿ ϭ͕ϭϳϳ^& ϭϬϬй Dd>ŽƉŝŶŐϰϯ^&ϰй ŽĨŽǀĞƌĂůůǁͬĐŽƉŝŶŐƌŝĐŬĂŶĚ'ůĂƐƐϳϱϰ^& ϲϰй ĂŶǀĂƐǁŶŝŶŐƐ Ϯϯ^&Ϭй KǀĞƌďƌŝĐŬDhϰϮϯ^& ϯϲй DĞƚĂůĐĂŶŽƉŝĞƐϯ^&фϭй KǀĞƌďƌŝĐŬSouthElevationϵϵϴ^& KǀĞƌĂůůǁͬŽƉŝŶŐWƌŝŵĂƌLJ&ŝŶŝƐŚĞƐ^ĞĐŽŶĚĂƌLJ&ŝŶŝƐŚĞƐKǀĞƌĂůů;ǁͬŽŽƉŝŶŐƐͿ ϵϱϱ^& ϭϬϬй Dd>ŽƉŝŶŐϰϯ^&ϰй ŽĨŽǀĞƌĂůůǁͬĐŽƉŝŶŐƌŝĐŬĂŶĚ'ůĂƐƐϲϭϴ^& ϲϱй ĂŶǀĂƐǁŶŝŶŐƐϬ^&Ϭй KǀĞƌďƌŝĐŬDhϯϯϳ^& ϯϱй DĞƚĂůĐĂŶŽƉŝĞƐϯ^&фϭй KǀĞƌďƌŝĐŬAllElevationsϳ͕ϵϵϬ^& KǀĞƌĂůůǁͬŽƉŝŶŐWƌŝŵĂƌLJ&ŝŶŝƐŚĞƐ^ĞĐŽŶĚĂƌLJ&ŝŶŝƐŚĞƐKǀĞƌĂůů;ǁͬŽŽƉŝŶŐƐͿ ϳ͕ϲϯϮ^& ϭϬϬй Dd>ŽƉŝŶŐϯϱϴ^&ϰй ŽĨŽǀĞƌĂůůǁͬĐŽƉŝŶŐƌŝĐŬĂŶĚ'ůĂƐƐϰ͕ϵϮϱ^& ϲϱй ĂŶǀĂƐǁŶŝŶŐƐ ϰϲϰ^&Ϭй KǀĞƌďƌŝĐŬDhϮ͕ϳϬϳ^& ϯϱй DĞƚĂůĐĂŶŽƉŝĞƐ ϭϮ^&фϭй KǀĞƌďƌŝĐŬϭ͘h/>/E'& Dd Z/>^d͗Ϯ͘& Z/<hE/d^hd/>/dz^/ ϭϮΗyϰΗyϰΗEKD/E>&/ >Z/<KhZ^/E'ϭͬϯZhEE/E'KEZ/<ϭ;&/ >Ϳ> EK&͗ E/KddͲΗhZ'hEz^E^Η;^E Z/<ͿϳϬй E/KddͲΗhdhDE^E^Η;^E Z/<ͿϯϬй Η><ΗZ/<^Z Z DKs Z/<ϮK>KZ͗ E/KddͲΗ/sKZz> EΗ;s >KhZ&/E/^,Ϳ;/E/d t/d,,d,Wdd ZEͿZ/<ϯK>KZ͗ E/KddͲΗKZ hy> EΗ;^DKKd,&/E/^,ͿDhϭK>KZ^͗ ^W>/d& ;^DKKd,& : EddKt><^Ϳ͗ &/EKZKd, Z^Ͳ&KZ/E/d/>^ > d/KEdK s Z/&/ t/d,^DW> ^͗ &/ >K>KZͲ&ͲϳϬ EdK>KZͲ&Ͳϳϱ ^K>/ ZKhZ^ KE DͲ^D ^& />K>KZ127( $33/<:$7(55(3(//(176($/(5720$6215<(;7(5,25685)$&(6(;7(5,25),1,6+127(6*(1(5$/127(6%5,&.&2/25 3$77(51.(<6&$/( ($67(/(9$7,21$ 6&$/( 6287+(/(9$7,21$ 6&$/( 1257+(/(9$7,21$ 6&$/( :(67(/(9$7,21$ (;7(5,25/,*+7,1*),;785(6),;785(&:$//02817('*226(1(&.6&21&(6,0,/$572 $13/LJKWLQJ(DV\2UGHU5/06LQJOH/LJKW7DOO/('2XWGRRU:DOO6FRQFHZLWK%DOODVW&DQRS\DQG9HQWHG6KDGH0RGHO :0/'1:.57&(&&7 .&RORU %ODFN),;785(%:$//02817(''2:1/,*+7 ,1$:1,1*6 6,0,/$572 %DVHOLWH.6HULHV/('6LJQ/LJKW83& &&7 .25.&RORU %ODFN),;785($685)$&(02817('/(' ,107/&$123,(6 6,0,/$572 6DWFR/LJKWLQJ:LGH,QWHJUDWHG/(')OXVK0RXQW6TXDUH&HLOLQJ)L[WXUH0RGHO 6&RORU %ODFN127( &2/257(03(5$785(21685)$&(02817('/('$1':$//02817(''2:1/,*+7608670$7&+3HUPLW5HYLHZ5HVSRQVHEXHIBIT HFINAL BUILDING ELEVATIONS 'DWH &RPPHQWV5HYLVLRQV'DWH [7KHVHGUDZLQJVDUHIRUFRQFHSWXDOXVHRQO\DQGDUHQRWLQWHQGHGIRUFRQVWUXFWLRQ)L[WXUHUXQVDQGTXDQWLWLHVVKRXOGEHYHULILHGSULRUWRRUGHU9DOXHVUHSUHVHQWHGDUHDQDSSUR[LPDWLRQJHQHUDWHGIURPPDQXIDFWXUHUVSKRWRPHWULFLQKRXVHRULQGHSHQGHQWODEWHVWVZLWKGDWDVXSSOLHGE\ODPSPDQXIDFWXUHUV6ROD(DJDQ01'UDZQ%\ -RH)UH\6DOHV$JHQW .HYLQ.DVPLVNLH6FDOH /6 /XPLQDLUH6FKHGXOH6\PERO4W\/DEHO$UUDQJHPHQW/XP/XPHQV//)'HVFULSWLRQ&DOFXODWLRQ6XPPDU\/XP:DWWV$UU:DWWV7RWDO:DWWV/DEHO&DOF7\SH8QLWV$YJ0D[0LQ$YJ0LQ0D[0LQ$6,1*/( 6/0/('/6,/)7&5,,/ 3DUNLQJORWDQGGULYHV,OOXPLQDQFH)F &6,1*/( 6/0/(' /6,/&5,,/6FDOH LQFK )W03/ 3,1( 3,1( &5$% &5$% &5$% 3,1(&5$% 7 7 + 5 ( ,( ,5 2 1 )(1 &(:&2 /8 0 1 6 %(1&+0$5. 71+ :0 + & 0+ 0+ & 0+ $ 0+ $ $ 0+ 0+ $ $ 0+ 0+ & EXHIBIT I FINAL SITE LIGHTING PLAN ,KHUHE\FHUWLI\WKDWWKLVSODQVSHFLILFDWLRQRUUHSRUWZDVSUHSDUHGE\PHRUXQGHUP\GLUHFWVXSHUYLVLRQDQGWKDW,DPDGXO\/LFHQVHG$UFKLWHFWXQGHUWKHODZVRIWKHVWDWHRI0LQQHVRWD0LFKDHO'.QLVHO\ 6LJQHG3ULQWHG1DPH'DWH 5HJ1R1R 'HVFULSWLRQ'DWH3HUPLW$SSOLFDWLRQ %LGGLQJ6LWH5HYLVLRQV([WHULRUDQG6LWH5HYLVLRQV3HUPLW5HYLHZ5HVSRQFH5HYLHZ5HVSRQVH 352-(&712 '5$:1%< &+(&.('%< $62/$($*$1($*$1287/(763$5.:$<($*$10,11(627$$5&+,7(&785$/6,7(3/$1'5$:,1*,1)250$7,21'5$:,1*7,7/(&23<5,*+7',67</('(6,*1$5&+,7(&763&)/$*$9(1257+0,11($32/,60,11(627$>@ 0'..')6 ( 03/75((75((75((75((75((75((75((75((75((75((3,1(3,1(&5$%&5$%&5$%3,1(&5$% 38%/,& 1,&2/652$' 38%/,& &('$5*529(3$5.:$< 38%/,& 759&3 2))3523(57</,1(775&3+66639&75'7 3(53/$16 3/$17(5%('63/$17(5%('6 0(7$/)(1&()281',521)281',521)52&./$1'6&$3(*5$66*5$66'5$,1$*($1'87,/,7<($6(0(173(53$5$*21$'',7,21/$1'6&$3(($6(0(1712/$1'6&$3(($6(0(17125( ,( )(+($*$1287/(76)281',5213$5.:$<'5$,1$*($1'87,/,7<($6(0(173(57+(3/$72)&('$5*529(3$5.:$<7+$'',7,21(;,67,1*%8,/',1*,521)(1&(:&2/8016'5$,1$*($1'87,/,7<($6(0(173(57+(3/$72)&('$5*529(3$5.:$<7+$'',7,21%(1&+0$5.71+ '5$,1$*($1'87,/,7<($6(0(173(57+(3/$72)&('$5*529(3$5.:$<7+$'',7,21%,780,1286%,780,128675$,/%,780,1286%,780,1286 5( ,( 6: ,( 6 ,( 1( ,( 1 5( 3 ,( 3 5 / ¬ 1 ( 6 :5 / ¬ 1 (6 :39&678%,( 3 ,( ,( 1 ,( 6 6,(+$ 63$&(6# 63$&(6# 63$&(6# 6,'(<$5' 6,'(<$5' &/59,6,21$5($&/59,6,21$5($ 63$&(6# 63$&(6 $,6/(# 63$&(6# 5 5 5 7<3#3$5.,1*&251(565 5 5 5 [ )5((67$1',1*$/803(5*2/$&21&67(36%,&<&/(3$5.,1* 63$&(6 +'&33$5.,1*$,6/(6,*166((127(352326('6(*0(17$/&21&%/2&.5(7$,1,1*:$//0$65()86((1&/2685(6((352326(''5,9($3521 $1'&85%&87352326('7,(72(;67:$/.127((/(&;)05127( :$//07$5($/,*+7:$//07$5($/,*+7$5($/,*+7$5($/,*+7$5($/,*+73523/,1(352326(' +%/$&.$/80)(1&($/21*5(7:$//6((3,3(%2//$5'6:$//$77$&+('$:1,1*6$1'&$123,(65(029$%/(:$//$77$&+('$:1,1*6$1'&$123,(65(029$%/(:$//$77$&+('&$123<:$//$77$&+('$:1,1*6$1'&$123,(6:$//$77$&+('$:1,1*6$1'&$123,(6$5($/,*+763/$6+%/2&.$7'6/2&$7+,66,'(2)%/'*$5($/,*+76721(08/&+352326('675,3,1*&87$7'5,9(&21&3$7,2 5$03352326('6725<0$6215< 67((/6$/21678',2%86,1(66 6) )22735,17 '1'1'1'1'1 '1 5$03'1$$ %8,/',1*',0(16,2166+2:1$5()520)$&(2))281'$7,21:$//6758&785($1'$5($3(53(1',&8/$572$1'3$5$//(/727+(3523(57</,1(1 ( (/(&7521,&),/(:,7+/$<287*(20(75<)25%8,/',1* :$/.6$9$,/$%/(83215(48(67)520$5&+,7(&7 $1*/(6$5($6680(' $7/2&$7,216127/$%(/(' &85%',0(16,216$5()520&85%)$&(81/(66127('27+(5:,6( &225',1$7(:,7+&,9,/'5$:,1*6 81/(66127('27+(5:,6(&85%6$5(',0,1,6+('$75$036 &21&5(7()/$7:25.$1'3$9(0(17%$6(6+$//%(35(3$5(',1$&&25'$1&(:,7+$33529('5(&200(1'$7,216)5207+(*(27(&+1,&$/,19(67,*$7,21 6((/$1'6&$3(3/$1)255(3/$&(0(173/$17,1*6$75(*5$'('$5($2:1(57268%0,7)259(5,),&$7,21%<&,7<2)($*$1'2&80(1766+2:,1*$&&(66$*07:35232:1(5)25$&&(66$1'5(7$,1,1*:$//(1&2$&+0(172)1(::25. (;670$6215<3,(56 $/80)(1&(725(0$,1 352326('1257+($67&251(502180(176(($6,7($5($&$/&8/$7,2166,7()($785($5($ 2)*5266$5($ *5266$5($723523(57<%281'5<52: 6) 1(7$5($ (;&/8',1*($6(0(176 ,03(50($%/(685)$&(6 0$,1%8,/',1* 6) :$/.63$5.,1*5()86(6) 3(50($%/(685)$&(6 /$1'6&$3(*5((163$&(6 6) 3$5.,1*3$5.,1*3529,'(' +$1',&$3$&&(66,%/(63$&(6 [ $//27+(563$&(6 [ 727$/ 16&$/( $5&+,7(&785$/6,7(3/$1$ 6&$/( 6,7(3/$1*(1(5$/127(6$ 6&$/( 6,7(3/$1/(*(1'$ 6&$/( 6,7(&$/&8/$7,216$ 3HUPLW5HYLHZ5HVSRQVHEXHIBIT AFINAL SITE PLAN Agenda Information Memo April 5, 2022, Eagan City Council Meeting CONSENT AGENDA Y. Approve On-Sale and Sunday Liquor License for J & K Inc doing business as Kyuramen at 1278 Town Centre Drive Suite 175 Action To Be Considered: To approve an On-Sale and Sunday Liquor License for J & K Inc doing business as Kyuramen at 1278 Town Centre Drive Suite 175 Facts: Jing Mei, Weikang Liang and Shengwu Li are owners of Kyuramen, have applied for an On-Sale and Sunday Liquor License for their establishment located 1278 Town Centre Drive Suite 175 expected to open in May 2022. All required documents have been submitted, reviewed, and deemed in order by City staff and the Police Department. Attachments: (0) Agenda Information Memo April 5 2022, Eagan City Council Meeting CONSENT AGENDA: Z. Adopt A Resolution Authorizing Signing Authority To The Chief Of Police To Receive Reimbursement For Tobacco Compliance Checks From the State Of Minnesota Department of Human Services Behavior Health Division Action To Be Considered: To adopt a resolution authorizing the Chief of Police to sign-off as the Signatory for the City of Eagan to receive reimbursement for educational tobacco compliance checks through the State of Minnesota. Facts: ➢ The Police Department is seeking to conduct educational tobacco compliance checks of forty-three (43) business. ➢ The State of Minnesota will reimburse compliance checks at $50 per occurrence. ➢ No penalties will be levied on businesses that fail compliance checks, however educational information will be provided. ➢ To receive reimbursement, compliance checks must be completed by June 30, 2022. ➢ The Police Department cannot begin checks until the agreement is finalized by the state. ➢ Allowing the Chief of Police to serve as the “Signatory” will expedite that process. ➢ The agreement has been reviewed by the city attorney’s office. Attachments: (1) Z-1 Resolution CITY OF EAGAN RESOLUTION AUTHORIZE SIGNING AUTHORITY TO THE CHIEF OF POLICE FOR THE STATE OF MINNESOTA, DEPARTMENT OF HUMAN SERVICES BEHAVIOR HEALTH DIVISION, FOR TOBACCO COMPLIANCE REIMBURSEMENT WHEREAS, the State of Minnesota, Department Human Services Behavior Health division is coordinating educational tobacco compliance checks and reimbursing participating communities; and WHEREAS, the City of Eagan desires to conduct tobacco compliance checks of at forty-three (43) businesses NOW, THEREFORE, BE IT RESOLVED by the City Council of Eagan, Minnesota as follows: 1) The Chief of Police is authorized to sign-off as the Signatory for the City of Eagan. 2) The Chief of Police shall ensure the police department adheres to all terms of this agreement. ADOPTED this _____ day of __________, 2022. CITY OF EAGAN CITY COUNCIL By: ____________________ It’s Mayor Attest: __________________ It’s Clerk Motion by: Seconded by: Those in Favor: Those Against: Date: Agenda Information Memo April 5, 2022, Eagan City Council Meeting CONSENT AGENDA AA. Approve temporary on-sale liquor licenses for the Eagan Rotary Community Service Foundation on May 7, 2022 at Eagan Festival Grounds located at Eagan Central Park, 1507 Central Pkwy Action To Be Considered: To approve temporary on-sale liquor licenses for the Eagan Rotary Community Service Foundation on May 7, 2022 at Eagan Festival Grounds located at Eagan Central Park, 1507 Central Pkwy Facts: The Eagan Rotary Community Service Foundation will be holding the Live to Give Walk at Eagan Central Park on May 7, 2022 The Eagan Rotary Community Service Foundation, which is a non-profit, has asked for the $150 temp on-sale liquor license fee be waived The organization has met the requirements for a temporary on-sale liquor license and has submitted the required documentation. The application has been reviewed by City staff and has been found in order for approval. Following Council approval, the application will be forwarded to the Department of Public Safety – Alcohol and Gambling Enforcement Division for final approval. Attachments: (0) Agenda Information Memo April 5, 2022 Eagan City Council Meeting PUBLIC HEARING A. Lot 12, Block 1 Prettyman Heights Easement Vacation Action To Be Considered: Close the public hearing and approve the vacation of a portion of the public drainage and utility easements on Lot 12, Block 1 Prettyman Heights (1563 Skyline Trail). Facts: On February 17, 2022, City staff received a petition from Matt Haugen, property owner of 1563 Skyline Trail, requesting the vacation of a portion of the existing drainage and utility easements on this property north of Lone Oak Road and east of Sibley Memorial Highway (State Highway 13), in northwestern Eagan. The purpose of the request is to vacate a portion of existing public easements to allow for a swimming pool to be installed in the backyard. Existing easements were originally dedicated with the original development of the property at no cost to the City. Standard easements would be maintained at 10 feet width on the side of the lot adjacent to Skyline Trail and 5 feet width adjacent to the other sides of the lot. As proposed, these standard drainage and utility easements would be adequate. Notices for a public hearing have been published in the legal newspaper and sent to all potentially affected and/or interested parties for comment prior to the public hearing. No objections to the vacation have been received or remain unresolved. This vacation request has been reviewed by the Public Works Department (Engineering Division) and found to be in order for favorable Council action. Attachments (3) PHA-1 Location Map PHA-2 Legal Description Graphics PHA-3 Power Point Presentation BLOOMINGTONMENDOTA HEIGHTS §¨¦494 §¨¦35E !(43 !(28 $+26 $+31 $+31 ÕÇ13 YANKEE DOODLE RD LEXINGTON AVEHWY 13PILOT KNOB RDCORPORATE CENTER DR. CORPORATE CENTER CUR. TRAPP RD. EAG. INDUST. RD. EA G. IN D U ST. R D.WEST SERVICE RD.EAGANDALE CT.CENTERCT.EAGANDALEB L V D B L U E G E N TIAN ROAD APOLLO RD. GEMINI RD.NEIL ARMSTRONG BLVD.LONE OAKCIRPROMENADEAVE.CLUBVIEW DR.DENMARK AVE.DENMARK AVE.YANKEE PL.O'LEA RYLNTOWNCENT R E DRIVE DUCKWOOD DR.FEDERAL DR.CENTRALP A R K W A Y HIGH SITE DR. NORWEST DR. 81ST ST. W A S HNTNDR.FOUR OAKS RD.COACHMAN RD.MEADOWVIEW RD. ALEXANDER RD.TERMINAL DR.YANKEE DR.C O M A N C H E R D . S H A W N E E R D. S E N ECARD.KENNEBEC DR.SILVER BELL RD. C E D AR G R O VE P KW Y .BLACKHAWK RD.NORT H W OODPKWY.Lexington Ave (Co Rd 43)Blackhawk Rd.Duckwood Dr. Yankee Doodle Rd. (Co. Rd. 28) Town Center Dr.Federal DrivePilot Knob Road (Co. Rd. 31)C edar G rove Pkw y.Silver Bell Rd. N o rt h w oodPa r k w ay Crestridge Dr.Towerview Rd.Denmark Ave Lone Oak Rd. (Co. Rd. 26) I-494 MN HWY 55 Location Map of ProposedEasement VacationLot 12, Block 1Prettyman Heights q Date: 2/22/2022 Location of ProposedEasement Vacation FIG 1. Document Path: L:\USERS\PUBWORKS\Engineer ing\TStrid\Easement Vacations\Lot 12, Blk1, Prettyman Heights.mxd FIG 2. Easement Vacation Public Drainage & Utility Easements Lot 12, Block 1 Prettyman Heights Petition received from Mr. Matt Haugen, property owner of 1563 Skyline Trail, requesting the vacation of public drainage & utility easements. Purpose is to vacate existing public easements to allow for a swimming pool to be installed in the backyard. The easement will be maintained for 10’ on the side of the lot facing the street and 5’ around the other sides of the lot. No outstanding objections. Lot 12, Block 1 Prettyman Heights Legal Description & Graphic Agenda Information Memo April 5, 2022, Eagan City Council Meeting OLD BUSINESS A. Comprehensive Guide Plan Amendment, Rezoning and Preliminary Planned Development – Rivers of Life Action To Be Considered: To implement a Comprehensive Guide Plan Amendment (or direct preparation of findings of fact for denial) to change the land use designation from LD (Low Density) to O/S (Office/Service) upon approximately 1.93 acres located at 2811 Pilot Knob Road, legally described as Lot 1, Highview Acres. To approve (OR direct preparation of findings of fact for denial) a Rezoning from R-1, Single-family residential to PD, Planned Development, to allow construction of a 28-unit memory care and assisted living facility upon property located at 2811 Pilot Knob Road, legally described as Lot 1, Highview Acres. To approve (OR direct preparation of findings of fact for denial) a Preliminary Planned Development to allow construction of a 28-unit memory care and assisted living facility upon property located at 2811 Pilot Knob Road, legally described as Lot 1, Highview Acres, subject to the conditions listed in the Advisory Planning Commission minutes. Required Vote For Approval: Comprehensive Guide Plan Amendment – At least four votes Rezoning and Preliminary Planned Development – At least three votes New information since the March 1, 2022, City Council meeting is in bold type. Facts: Comprehensive Guide Plan Amendment: The City previously considered a land use amendment to change the designation of the site to Office/Service (O/S) allowing for construction of a memory care and assisted living facility. The Advisory Planning Commission held a public hearing on the request at the September 28, 2021, meeting, and failed to recommend approval or denial, with both motions failing on a split 3-3 vote. On October 15, 2021, the City Council directed that the Comprehensive Guide Plan Amendment be forwarded to the Metropolitan Council for review. On November 30, 2021, the Metropolitan Council approved the land use amendment, allowing the City to implement it. It is the City’s practice to hold off on implementing land use changes until accompanied by specific development plans. Rezoning and Preliminary Planned Development Amendment: The City Council reviewed this proposal at the March 1, 2022, meeting and continued the item to address several issues, primarily to include access onto Pilot Knob Road. The property consists of one parcel on the northwest corner of Pilot Knob Road and Highview Avenue. The property was platted in 1947 and contains a single- family home built in 1952. The applicant is proposing to redevelop the site with a one-story 28-unit memory care and assisted living facility. The PD zoning affords flexibility to typical zoning standards for better site design and mutual benefit. The proposed Planned Development is based on the Limited Business (LB) zoning district, which is consistent with the pending O/S land use designation and within which the proposed use is considered conditional. The acceptability of the proposed Planned Development is a policy matter for city officials. The site is located within Aircraft Noise Overlay District Zone 4, within which the use is considered conditional. To approve development in this area, the City Council would need to make acceptable findings concerning the specific standards outlined in the staff report, and sound attenuation construction standards would apply. The proposed site plan shows an L-shaped building on the west and northwest portion of the site, with parking and stormwater infiltration to the east. Driveway access to Pilot Knob Road will be closed and a new driveway access constructed from Highview Avenue. A pedestrian connection to the trail along Pilot Knob Road is shown at the north end of the site, with a monument sign on the southeast corner and a detached trash enclosure on the southwest corner. (See below regarding site modifications include access onto Pilot Knob Road). Dakota County’s long-term plan anticipates Pilot Knob Road being widened in the future. The county will need to acquire additional right-of-way (an additional 25 feet is anticipated) if/when the road is widened. The following are considered deviations to typical City Code standards: o Reduced pavement setback on the south side (less than 20 feet from public right-of-way). o Building coverage ratio of 28.4 percent as compared to the typical maximum of 20 percent. (See below for changes) o Trash enclosure detached from the principal structure. No wetlands are present on the site, and minimum green space standards are satisfied. The preliminary grading, stormwater, utility and landscape plans are acceptable with some modifications at the time of Final Planned Development. Tree removal is less than the allowable limit and no mitigation is required. Proposed building architecture is quasi-residential in character, a single story with a pitched roof and two types of siding and simulated stone finish. However, the proposed exterior materials do not meet City Code standards and should be modified for the Final Planned Development. (See below for changes) Highview Park is located approximately one-quarter mile from the site, and Central Park/Eagan Community Center is within one mile. The trail on Pilot Knob Road provides a connection to parks and the city-wide trail system. With redevelopment and the change in use, cash park and trail dedication will be due with the building permit at the rates then in effect. The Advisory Planning Commission held a public hearing on February 22nd and unanimously (6-0) approved both the Rezoning and Preliminary Planned Development. Issues: The applicant has submitted revised plans that redesign the front parking and stormwater management areas and keep the existing driveway access to Pilot Knob Road. The revised plans also show: o The building footprint reduced from 23,858 to 22,992 square feet with the lot coverage ratio now at 27.4 percent, down from the previous 28.4%. o In addition to a slightly smaller building footprint and lot coverage ratio, green space also increased from 45.4 percent up to 50.6 percent. o Tree Preservation does not appear to be significantly impacted by the changes, and most perimeter trees continue to be preserved as they were in the initial proposal. o Landscape screening for the parking lot was supplemented, and more foundation plantings were added along the rear of the building. o The entire parking lot was redesigned to accommodate the driveway onto Pilot Knob Road, and the Highview Avenue driveway was relocated closer to the Pilot Knob Road intersection. o Architectural drawings switched the “simulated stone veneer” to simply “stone veneer.” The building appearance stays the same, but the Class I ratio was increased, the aggregate total is 55.92 percent and 65.69 percent if roof gables are excluded. Most individual elevations are between 60 percent and 65 percent Class I; the southeast (entry) elevation has the lowest Class I ratio at 40.81 percent. Staff contacted Dakota County regarding access onto Pilot Knob Road. The County has reiterated its standards and position to have the access eliminated. The City Attorney will update Council on this matter during the meeting. If the County prohibits access onto Pilot Knob Road, the Planned Development will return to City Council as a Planned Development Amendment. It has come to staff’s attention that the additional setback standard for the County Road is 50 feet from the right-of-way or 125 feet from the centerline, whichever is greater. In this case, the 125-foot measure is greater, and places the setback line 25 feet further west than the 50-foot setback shown on the site plan. Measuring the setback from the centerline better accounts for future right- of-way needs. As proposed, the building is set back 50 feet from the current right-of-way, and is 25 feet less than the required setback as measured from the right-of-way centerline. This is an additional deviation not mentioned in the staff report. If/when the County acquires the additional 25 feet of right-of-way in the future, the building will then be set back 25 feet from the right-of-way. 60-Day Agency Action Deadline: Initially April 3, 2022, extended to June 2, 2022 Attachments: (7) OBA-1 Location Map OBA-2 Revised Plans OBA-3 City Meeting Minutes (March 1 and Feb. 22, 2022; Oct. 5 and Sept. 28, 2021) OBA-4 Planning Report OBA-5 Report Exhibits OBA-6 Public Correspondence (Comprehensive Plan Amendment) OBA-7 Metropolitan Council Approval Letter C.S.A.H. NO. 31 (PILOT KNOB ROAD)EAGAN INDUSTRIAL ROAD BU RNSID E AVENUEPOPPLER LANEE G A N A V E N U E LOON LANEBRIDGEVIEW AVE STEPHANIE CR EAGANDALE BOULEVARDCORP. CENT. DR. HIGHVIEW AVE CORPORATE CENTER DRIVE VILASLANES KYLIN E CT EAGA N D A LEPLACEINTERSTATE HWY. NO. 35ETOWERVIEW ROAD TOWERVIEW ROAD EAGANDALEBLVDOSTER DR R A I N I E R LANE DRIVE HIGHVIEW TERRACESIBLEY HILLS DRVINCE TR CENTERCOURTBEAMLANEEAGANDALE BLVDBRIDGEVIEW TERRACEPINERIDGEDRIVESKYLINETR C.S.A.H. NO.26 (LONE OAK ROAD)WO: 52497EAGA N D A LE CT AVALON AVENUE SKYLINE DRIVEHIGHRIDGEWOODLARK LANEINTERSTATE HWY. NO. 494 TRAPP ROAD EGANAVENUEM C C A R T H Y R O A D BURNSIDEAVENUETERRACESTATETRUNKHWY.NO.13SOUTHRIDGE AVE RED CEDAR ROAD FAI R L A WN P L A C E INLANDROADSHIELDSDR.C ORPORATE CENTER CUR V E RUSTICHILLSDRWESTSERVICE ROAD SKYLINECHERRYWOOD CTMCCART H Y R D SKYLIN E R OAD PATH HIGHVIEW AVE EA G A N IN D U STRIAL R O A D SKYLINE DR PilotKnob Park CountryHome Park Highview Park Fort SnellingState Park Location Map 0 1,000500 Feet ´ §¨¦35E §¨¦494 Cliff Rd Diffley Rd Yanke e Do odle Rd Lone Oak Rd Map Area Extent Project Name: Rivers of LifeRequest: Rezoning and Preliminary Planned DevelopmentFile Nos.: 04-RZ-01-01-22 04-PD-01-01-22Subject Site A2.0A5 A2.0 B3 A2.0 B1 A2.0 A4A2.0A3A2.0B2 A2.0 A1 A2.0A2 WATER METER UNIT 4 UNIT 9 UNIT 10 UNIT 11 I.T. UNIT 8 UNIT 6 UNIT 7 UNIT 5 UNIT 1 CONFERENCE STORAGE NURSE COVERED PORCH OFFICE UNIT 2 LAUNDRY UNIT 3 SOUTH DINING CORRIDOR CORRIDOR LIVING AREA CORRIDOR CORRIDOR LIVING AREA MAIN DINING LIVING AREA RECEPTION VESTIBULE NORTH DINING CORRIDOR ACTIVITY DESK LIVING AREA CORRIDORCORRIDOR LIVING AREA TLT STOR. STORAGE CORRIDOR ELECTRICAL METER GAS METER EXTERIOR TRASH ENCLOSURE, SEE CIVIL TOTAL BUILDING 22,992 GROSS SF TYPICAL UNIT 328 NET SF TYPICAL UNIT 328 NET SF MECHANICAL EQUIPMENT SCREEN WALL OF SAME MATERIAL AS BUILDING MECHANICAL EQUIPMENT SCREEN WALL OF SAME MATERIAL AS BUILDING MECHANICAL EQUIPMENT SCREEN WALL OF SAME MATERIAL AS BUILDING MECH ELECTRICAL JAN. TUB ROOM SPA SUNROOM KITCHEN KITCHEN STORAGE DOAS GEN TRAN DOAS DOAS UNIT 16 UNIT 18 UNIT 20 UNIT 22 UNIT 24 UNIT 26 UNIT 28 UNIT 12 UNIT 13 UNIT 14 UNIT 15 UNIT 17 UNIT 19 UNIT 21 UNIT 23 UNIT 25 UNIT 27 LAUNDRY STORAGE TLT STORAGE STAFF WATER TOTAL BUILDING 22,992 GROSS SF 22,992 SF / 83,998 SITE SF = 27.4% Copyright 2021 DJR Architecture, Inc. A1.0 FLOOR PLAN EAGAN, MN RIVERS OF LIFE -EAGAN 21-092.00 3/18/2022 PRELIMINARY PLANNED DEVELOPMENT APPLICATION 3/32" = 1'-0"A1 FLOOR PLAN -LEVEL 1 N CEMENTITIOUS SHAKES CEMENTITIOUS LAP SIDING ASPHALT SHINGLES DECORATIVE SCONCES STONE VENEER SIGNAGE BY OTHERS APPROX. 30 SF 24'-1 1/4" @ PEAKCEMENTITIOUS SHAKES CEMENTITIOUS LAP SIDING ASPHALT SHINGLES DECORATIVE SCONCES STONE VENEER 17'-6 7/8" TO MID OF ROOFCEMEMTITIOUS LAP SIDING ON MEP SCREENING ROOFTOP CONDENSERS CONCEALED BY ROOF CEMENTITIOUS SHAKES CEMENTITIOUS LAP SIDING ASPHALT SHINGLES DECORATIVE SCONCES STONE VENEER CEMEMTITIOUS LAP SIDING ON MEP SCREENING ROOFTOP CONDENSERS CONCEALED BY ROOF CEMENTITIOUS SHAKES CEMENTITIOUS LAP SIDING ASPHALT SHINGLES DECORATIVE SCONCES STONE VENEER ROOFTOP CONDENSERS CONCEALED BY ROOF CEMENTITIOUS SHAKES CEMENTITIOUS LAP SIDING ASPHALT SHINGLES DECORATIVE SCONCES STONE VENEER CEMEMTITIOUS LAP SIDING ON MEP SCREENING ROOFTOP CONDENSERS CONCEALED BY ROOF CEMENTITIOUS SHAKES CEMENTITIOUS LAP SIDING ASPHALT SHINGLES DECORATIVE SCONCES STONE VENEER CEMEMTITIOUS LAP SIDING ON MEP SCREENING ROOFTOP CONDENSERS CONCEALED BY ROOF CEMENTITIOUS SHAKES CEMENTITIOUS LAP SIDING ASPHALT SHINGLES DECORATIVE SCONCES STONE VENEER MEP VENTING SHOWN SHADED, VERIFY W/ MEP CEMEMTITIOUS LAP SIDING ON MEP SCREENING CEMENTITIOUS SHAKES CEMENTITIOUS LAP SIDING ASPHALT SHINGLES DECORATIVE SCONCES STONE VENEER CEMEMTITIOUS LAP SIDING ON MEP SCREENING ROOFTOP CONDENSERS CONCEALED BY ROOF CEMENTITIOUS LAP SIDING STONE VENEER Copyright 2021 DJR Architecture, Inc. A2.0 EXTERIOR ELEVATIONS EAGAN, MN RIVERS OF LIFE -EAGAN 21-092.00 3/18/2022 PRELIMINARY PLANNED DEVELOPMENT APPLICATION 3/32" = 1'-0"A3 SOUTHEAST EXTERIOR ELEVATION (ENTRY) 3/32" = 1'-0"A1 EAST EXTERIOR ELEVATION A 3/32" = 1'-0"A2 SOUTH EXTERIOR ELEVATION A 3/32" = 1'-0"A4 EAST EXTERIOR ELEVATION B 3/32" = 1'-0"A5 SOUTH EXTERIOR ELEVATION 3/32" = 1'-0"B1 WEST EXTERIOR ELEVATION 3/32" = 1'-0"B2 NORTHWEST EXTERIOR ELEVATION 3/32" = 1'-0"B3 NORTH EXTERIOR ELEVATION EAST A Material Area Percent Stone 479sf 48.89% Fiber Cement Lap 233sf 23.78% Fiber Cement Shakes 116sf 11.84% Glazing 152sf 15.49% Total:980sf 100% Class I Materials 64.38% SOUTH A Material Area Percent Stone 354sf 38.27% Fiber Cement Lap 246sf 26.59% Fiber Cement Shakes 108sf 11.68% Glazing 194sf 20.97% Door (HM)23sf 2.49% Total:925sf 100% Class I Materials 59.24% SOUTHEAST Material Area Percent Stone 112sf 15.14% Fiber Cement Lap 208sf 28.11% Fiber Cement Shakes 230sf 31.08% Glazing 190sf 25.67% Total:740sf 100% Class I Materials 40.81% NORTHWEST Material Area Percent Stone 344sf 27.02% Fiber Cement Lap 204sf 16.03% Fiber Cement Shakes 531sf 41.71% Glazing 167sf 13.12% Door (HM)27sf 2.12% Total:1662sf 100% Class I Materials 40.14% NORTH Material Area Percent Stone 519sf 41.45% Fiber Cement Lap 342sf 27.32% Fiber Cement Shakes 132sf 10.54% Glazing 259sf 20.69% Total:1252sf 100% Class I Materials 62.14% WEST Material Area Percent Stone 818sf 44.65% Fiber Cement lap 549sf 29.97% Fiber Cement Shakes 108sf 5.90% Glazing 357sf 19.48% Total:1778sf 100% Class I Materials 64.13% EAST B Material Area Percent Stone 580sf 40.31% Fiber Cement Lap 411sf 28.56% Fiber Cement Shakes 108sf 7.51% Glazing 292sf 20.28% Door (HM)48sf 3.34% Total:1409sf 100% Class I Materials 60.59% EAST B Material Area Percent Stone 478sf 48.78% Fiber Cement Lap 235sf 23.98% Fiber Cement Shakes 116sf 11.84% Glazing 151sf 15.40% Total:993sf 100% Class I Materials 64.27% 3/32" = 1'-0"B4 TRASH ENCLOSURE FRONT 3/32" = 1'-0"B5 TRASH ENCLOSURE SIDE TOTAL CLASS I MATERIALS Material Area Percent Stone 3,684sf 37.83% Glazing 1,762sf 18.09% 5,446sf 55.92% Class I Materials 55.92% Class I Materials without roof gables included 65.69% CEMENTITIOUS SHAKES - LIGHT GREY CEMENTITIOUS LAP SIDING - DARK GREY ASPHALT SHINGLES - BLACK STONE VENEER CEMENTITIOUS TRIM, FASCIA & SOFFITS -IVORY STOREFRONT -CLEAR ANNODIZED CEMEMTITIOUS LAP SIDING ON MEP SCREENING ROOFTOP CONDENSERS CONCEALED BY ROOF ALUMINUM FENCING Copyright 2021 DJR Architecture, Inc. A2.1 EXTERIOR ELEVATIONS EAGAN, MN RIVERS OF LIFE -EAGAN 21-092.00 3/18/2022 PRELIMINARY PLANNED DEVELOPMENT APPLICATION 1/8" = 1'-0"A1 SOUTH EXTERIOR ELEVATION 1/8" = 1'-0"A2 EAST EXTERIOR ELEVATION 1/8" = 1'-0"A3 WEST EXTERIOR ELEVATION 1/8" = 1'-0"A4 NORTH EXTERIOR ELEVATION 1/8" = 1'-0"B1 TRASH ENCLOSURE FRONT COLOR Copyright 2021 DJR Architecture, Inc. A3.0 EXTERIOR RENDERING EAGAN, MN RIVERS OF LIFE -EAGAN 21-092.00 3/18/2022 PRELIMINARY PLANNED DEVELOPMENT APPLICATION COMPREHENSIVE GUIDE PLAN AMENDMENT, REZONING, and PRELIMINARY PLANNED DEVELOPMENT – Rivers of Life – Mark Abel City Administrator Osberg introduced the item noting the request is a Comprehensive Guide Plan Amendment from Low Density (LD) to Office/Service (O/S), a Rezoning from R‐1, Residential Single Family to PD, Planned Development, and a Preliminary Planned Development to allow a 28‐unit memory care/ assisted living facility located at 2811 Pilot Knob Road. City Planner Schultz presented a staff report and a site map. The architect was present to answer questions from the Council. The Council discussed the site access shown on the current plan, where the only access is via Highview Avenue. The architect stated that this was due to conversations with Dakota County that implied access via Pilot Knob was not permitted. Public Works Director Matthys clarified Dakota County may prefer the access not be on Pilot Knob Road, but because there is no plat requirement, they cannot require it. Councilmember Supina stated preference for an access to Pilot Knob Road that could serve the property, while eliminating the access to the site from Highview Avenue. Councilmember Bakken stated that he could not support the redevelopment if the only access to the property was via Highview Avenue. Mayor Maguire called for comments from the public. Marvin Youness, 1426 Highview Avenue, stated the issue of access to the site is still of concern to the neighborhood. His questions on the need for an environmental impact study and park dedication funds were addressed. Mayor Maguire returned the discussion to the Council for further discussion and motion. Council voiced concerns regarding the lack of access onto Pilot Knob Road. Council suggested the applicant consider waiving the 60‐day review to allow plan revisions addressing Councils concerns. City Attorney Bauer stated the plan may need further review by the Advisory Planning Commission, but would depend on the significance of the plan changes. Councilmember Fields moved, Councilmember Bakken seconded a motion to continue this item indefinitely. Aye: 5, Nay: 0, Motion Carried. Advisory Planning Commission February 22, 2022 Page 22 of 36 C. Rivers of Life Applicant Name: Mark Abdel Location: 2811 Pilot Knob Rd; Lot 1, Highview Acres Application: Rezoning A Rezoning from R‐1, Residential Single Family to PD, Planned Development for a memory care / enhanced assisted living community. Application: Preliminary Planned Development A Preliminary Planned Development to allow a 28‐unit memory care/ assisted living facility. File Number: 04‐PD‐01‐01‐22 Planner Pam Dudziak introduced this item and highlighted the information presented in the City Staff report dated February 17, 2022. Chair Sagstetter asked the applicant to approach the dais and if they wanted to add to the staff presentation. Mark Abdel, Rivers of Life, introduced himself and summarized the proposal, identifying refinements to the development plans they made to address City and Dakota County requirements, and neighbor concerns. Member Abdel welcomed any questions for him or his team. Chair Sagstetter asked the Commission for any questions of the applicant. Vice Chair Jensen asked Mr. Abdel to clarify the duration of the registered emergency calls at the Savage location. Mr. Abdel responded about 12 emergency trips which has been open approximately one year. Chair Sagstetter opened the public hearing. Matt Youness, 1420 Highview Avenue, asked for clarification regarding the size of water and sewer utilities to serve the new development. Shari Loushin, 1451 Highview Avenue, asked for clarification regarding the County’s recommendation to close accesses along Pilot Knob Road and taking access off Highview Avenue. Mrs. Loushin asked what happens if this company sells in the future, what other uses can go on the property. Chair Sagstetter asked Assistant City Engineer Nelson to address the resident questions. Mr. Nelson clarified that the current water and sewer services are only capable of serving the single‐family property. Those services would need to be abandoned and new services would be Advisory Planning Commission February 22, 2022 Page 23 of 36 taken from Highview Avenue. He noted residents could experience a brief interruption of service. Chair Sagstetter asked Mr. Nelson to address the access question. Assistant City Engineer Nelson explained Dakota County’s policy to limit direct access to Pilot Knob Road where possible for safety reasons. Also, a permit from Dakota County would be needed for the new development to have a driveway to Pilot Knob Road, and the County will not issue the permit since an alternative for access exists from Highview Avenue. Chair Sagstetter stated that the Planned Development would limit the use of the property based on the approved Plan. City Planner Mike Schultz explained that the PD zoning is specific to this use, so any different use of the property in the future would require an Amendment to the Planned Development There being no further public comment Chair Sagstetter closed the public hearing and turned the discussion back to the Commission. Member Cherner noted that he was satisfied that the applicant addressed most, if not all, of the comments from City Council [from the initial Comprehensive Guide Plan Amendment]. Member Cherner moved, Member Whisnant seconded a motion to recommend approval of a Rezoning from R‐1, Single‐family to PD, Planned Development upon property located at 2811 Pilot Knob Road, legally described as Lot 1, Highview Acres. All voted in favor. Motion carried 6‐0. Member Cherner moved, Member Whisnant seconded a motion to recommend approval of a Preliminary Planned Development to allow a 28‐unit memory care and assisted living facility upon property located at 2811 Pilot Knob Road, legally described as Lot 1, Highview Acres, subject to the following conditions: 1. A Preliminary Planned Development Agreement shall be executed and recorded against the property at the Dakota County Recorder’s office. The Preliminary PD Agreement shall contain the following plans: Preliminary Site Plan Preliminary Building Elevations Preliminary Landscape Plan Preliminary Site Lighting Plan Preliminary Signage Plan 2. A Final Planned Development Agreement shall be required prior to issuance of a Building Permit. The following plans are required for the Final Planned Development Agreement and shall be consistent with the approved Preliminary Planned Development: Advisory Planning Commission February 22, 2022 Page 24 of 36 Final Site Plan Final Building Elevations Final Landscape Plan Final Site Lighting Plan Final Signage Plan 3. The Planned Development shall have a term of three (3) years. 4. This Preliminary Planned Development approves a one‐story assisted living and memory care facility with 28 units. 5. The building exterior shall conform with City Code standards which require at least two Class I materials comprising at least 65 percent of the building and no more than 35 percent Class II and Class III materials. 6. The trash enclosure shall be designed consistent with City Code standards in compliance with City Code Section 11.70 Subd. 21.D.7. 7. All signage shall be subject to compliance with the City Sign Code standards, and a Sign Permit shall be obtained prior to installation of any signs. 8. Site lighting shall be provided in conformance with City Code standards. Fixtures shall be downcast and shielded so the source of light is not visible from off the property, illumination throughout the parking lot should be not less than 0.5 footcandles and shall not exceed 1.0 footcandle at the property line. 9. All erosion/sediment control plans submitted for development and grading permits shall be prepared by a designer who has received current Minnesota Department of Transportation (MNDOT) training, or approved equal training as determined by the City Engineer in designing stormwater pollution prevention plans. Also, all personnel responsible for the installation of erosion/ sediment control devices, and the establishment of vegetation for the development, shall have received Erosion/Sediment Control Inspector/Installer certification through the University of Minnesota, or approved equal training as determined by the City Engineer. 10. This development shall comply with Eagan’s Land Disturbance Stormwater Pollution Prevention and Post‐Construction Stormwater Management Requirements (City Code Section 4.34) for stormwater management and surface water quality, including land disturbance requirements, and Runoff Rate Control and 1.1‐inch Volume Control of effective retention of the site’s impervious surface area (including effective soil remediation for all of the site’s disturbed soils that are to be revegetated). 11. Prior to receiving City approval to permit land disturbing activity, the applicant shall provide to the City with soil borings equally spaced within the footprint of any proposed infiltration feature, extending a minimum of 10 feet below the bottom of Advisory Planning Commission February 22, 2022 Page 25 of 36 the proposed infiltration excavation with continuous sampling, to evaluate and ensure suitability for infiltration of stormwater, including, but not limited to, depth to saturated soils and P200 analysis if SM soils are encountered below the excavation extent. A minimum of three (3) soil borings must be provided within the footprint of the proposed stormwater infiltration basin. If the soil boring logs indicate incompatibility of existing sub‐soil permeability, or shallow groundwater conflict, with the submitted and reviewed design plans for meeting volume control requirements, the applicant shall revise the design and/or construction plans to ensure water quality equivalent of volume control requirements are fully met for the mitigated impervious drainage area, to the satisfaction of the City Engineer. 12. The applicant shall provide adequately sized pre‐treatment structures (e.g. 4‐foot minimum depth sump, 5‐foot minimum diameter, with floatable skimmer hood) at, or immediately upstream of, any stormwater infiltration facility inlet to provide for effective capture and easily‐accessible cleanout of fine‐sand sized particles and floatable pollutants. Pre‐treatment structures shall be accessible by appropriate maintenance equipment. Details shall be included in applicable plan sheet(s) using Eagan Standard Detail Plate E231. 13. Prior to receiving city approval to permit land disturbing activity, the applicant shall provide construction details of the proposed infiltration basin following MPCA Minnesota Stormwater Manual Standards & City Engineering Standards for Infiltration Basins for City review/acceptance by the City Engineer and include in construction plans. Construction details shall include infiltration basin cross‐sections, construction/protection/inspection notes, infrastructure components involved, sub‐ soil testing/loosening, soil media specifics, and planting/stabilization specifics, to ensure infiltration practices are properly designed, constructed, planted, and adequately protected during / after construction to prevent clogging, and able to be properly maintained to function as intended. Infrastructure details shall be included for stable inlets, outlets and emergency overflows and unobstructed access for inspections and maintenance of inlets/outlets. Details for basin soil requirements shall include sub‐soil infiltration testing for the infiltration basins following City/MPCA guidelines, sub‐soil ripping of 18‐inch depth minimum x 18‐inch maximum spacing at over‐excavation prior to soil amendment backfilling, and appropriate soil amendment criteria. Details for planting and stabilization requirements shall include live planting at 18‐inch on‐center spacing of all basin bottom area, seeded or live‐planted side‐ slopes, and permanent erosion‐control details for basin bottom and side‐slopes, etc. These graphical details and notes shall be prominently included in all applicable plan sheets (e.g. Grading Plan, Utility Plan, Details, etc.). Notes shall be provided that grading and utility contractor(s) shall provide 24‐hours advance notice to City Water Resources Staff of any grading or utility work involving the proposed infiltration basin, including installation of all inlets and outlets, including contact email and phone number for City Water Resources Staff. Advisory Planning Commission February 22, 2022 Page 26 of 36 14. During infiltration system over‐excavation/sub‐soil work, the applicant shall ensure that a Certified Soil Scientist will be present to verify and document that practice area sub‐soils are suitable for a saturated‐state infiltration rate of no less than 0.7‐inches per hour (based on 0.35‐inch per hour design rate with 2x safety factor) or greater (but less than 8.0‐inch per hour). If the sub‐soil infiltration rates are less than 0.7‐ inches per hour (or greater than 8.0‐inch per hour), the applicant shall immediately notify the City Engineer and revise the volume control practice(s) design and construction as necessary (e.g. over‐excavation/soil‐amendment depth, etc.) to ensure volume control requirements are fully met. Verification of sub‐soil infiltration testing rates shall be provided immediately to the City of Eagan on the day of infiltration testing. The applicant shall ensure that the City Water Resources staff is provided 24‐hour advance notice of the occurrence of infiltration verifications and also provided notice prior to any excavation and/or soil backfilling within the infiltration practices, to arrange for inspections. 15. Prior to receiving city approval to permit land disturbing activity, the property owner shall provide detailed Soil Management Strategies in the plan set for City review, and acceptance by the City Engineer, that provide graphical details and notes on soil protection/restoration in the Stormwater Management Plan and prominently included in all applicable plan sheets (e.g. Erosion & Sediment Control Plan, Grading Plan, Landscape Plan, etc.) and shall specify estimated quantities of soil ripping area and volume of compost to be imported and incorporated on pertinent plan sheet quantity tables. Prior to receiving a Certificate of Occupancy for any affected construction, Soil Management Strategy implementation documentation (e.g. haul tickets, representative on‐site soil samples, compaction testing and soil organic content test results) shall be provided to City Water Resources staff to verify approved soil management strategy compliance. Notes shall be provided that implementing contractor shall provide 24‐hours advance notice to City Water Resources staff prior to implementation of soil loosening and amendment. 16. Prior to proceeding with land disturbing activity, the Property Owner shall enter into a long‐term stormwater management system maintenance agreement with the City, detailing the annual inspection and maintenance required to occur to ensure proper operation and performance of the private permanent stormwater management system, in a form acceptable to the City Attorney. 17. Before the city returns any Stormwater‐related Performance Guarantee Fees on the development site, the applicant shall demonstrate that all stormwater management practices are performing as intended and shall provide the City Engineer as‐built plans meeting City requirements for as‐built standard submittals that demonstrate that all constructed stormwater conveyance structures, stormwater management facilities (sumps, infiltration basin, etc.), including soil loosening & amendment prior to landscaping, conform to design and/or construction plans, as approved by the City. Photos/video of final inspection of clean underground infiltration chamber gallery systems and contributing storm sewer shall be provided to the City Engineer. The Advisory Planning Commission February 22, 2022 Page 27 of 36 applicant shall submit to the City Engineer certification that the stormwater management facilities have been installed in accord with the plans and specifications approved. This certification shall be provided by a Professional Engineer licensed in the State of Minnesota. 18. The street, curb and gutter, trail, and boulevard shall be restored in a manner acceptable to the City Engineer. 19. This development shall provide hydrant spacing and locations in accordance with City Fire Department and Public Works standards. 20. The applicant shall dedicate standard drainage and utility easements around the perimeter of the property in a form acceptable to the City Attorney. 21. The applicant shall obtain a separate right‐of‐way permit from the City for any work within the Highview Avenue right of way. 22. The applicant shall provide a contractor parking and staging plan prior in a manner acceptable to the City Engineer, prior to approval of any land disturbing activities. 23. All construction and/or silt fence shall be installed on the back side of the trail and no closer than two feet from the edge of the trail. Between November 1 and April 1, all fencing shall be located at least five feet from the back side of the trail and back of curb. 24. This development shall accept its additional financial obligations as defined in the staff’s report in accordance at the time of building permit. 25. This development shall dedicate adequate drainage and ponding easements, in accordance with requirements set forth in the latest version of the City’s Stormwater Management Plan. 26. The development shall be responsible for the acquisition of all regulatory agency permits required by the affected agency prior to the issuance of a building permit. 27. The applicant shall submit a revised tree preservation plan and tree data table that rectifies critical root zone encroachments and recalculates mitigation as necessary. Should mitigation be required, the applicant shall also submit a Tree Mitigation Plan showing the fulfillment of the required tree mitigation for approval prior to Final Planned Development or Final Subdivision. The Tree Mitigation Plan shall show the number of, size, and species of all required mitigation trees in plan form as well as tabular form. Mitigation trees are in addition to landscape requirements and shall be labeled as such on an overall Landscape and Tree Mitigation Plan. If required mitigation trees cannot fit on site, the balance of mitigation shall be provided as cash payment as identified in the City’s Fee Schedule. Advisory Planning Commission February 22, 2022 Page 28 of 36 28. Tree protective measures shall be placed at the drip line or at the perimeter of the Critical Root Zone (CRZ), whichever is greater. If tree protection fencing cannot be placed and maintained at the required distance from preserved trees, then either a) these trees shall be considered as removed; or b) a Tree Health Management Plan prepared by a certified arborist shall be provided indicating tree management activities to be implemented that will ensure the survival of these trees. 29. In accordance with the Tree Preservation Ordinance, a Performance Guarantee shall be provided in the amount of $25.00 per diameter inch to ensure the preservation of all significant trees within 15 feet of the construction zone. 30. The applicant shall contact the City Forestry Division and set up a pre‐construction site inspection at least five (5) days prior to the issuance of the Grading Permit to ensure compliance with the approved Tree Preservation Plan and placement of the Tree Protection Fencing. All voted in favor. Motion carried 6‐0 PLANNING REPORT CITY OF EAGAN REPORT DATE: February 17, 2022 CASE: 04-RZ-01-01-22; 04-PD-01-01-22 APPLICANT: Rivers of Life HEARING DATE: February 22, 2022 PROPERTY OWNER: Eric K Drenckhahn Trust APPLICATION DATE: February 2, 2022 REQUEST: Rezoning and Preliminary PREPARED BY: Pam Dudziak Planned Development LOCATION: 2811 Pilot Knob Road COMPREHENSIVE PLAN: LD, Low Density ZONING: R-1, Single-Family SUMMARY OF REQUEST The applicant is requesting approval of a Rezoning from R-1, Single-family Residential to PD, Planned Development, and a Preliminary Planned Development to allow a 28-unit memory care and assisted living facility upon property located at 2811 Pilot Knob Road, legally described as Lot 1, Highview Acres. AUTHORITY FOR REVIEW Rezoning: City Code Chapter 11, Section 11.50, Subd. 5 states in part, 1. The provisions of this chapter may be amended by the majority vote of the council, except that amendments changing the regulations of any district may only be made by an affirmative vote of two-thirds of all members of the council. 2. The City Council shall not rezone any land or area in any zoning district or make any other proposed amendment to the zoning ordinance without first having referred it to the planning commission for its consideration and recommendation. Planning Report – Rivers of Life February 22, 2022 Page 2 Planned Development: City Code Chapter 11.60, Subd. 18, A., states the intent of the Planned Development zoning district as follows: 1. Providing greater flexibility in environmental design and relaxation of strict application of the zoning ordinance in exchange for greater creativity and environmental sensitivity. 2. Recognizing the economic and cultural advantages that will accrue to the residents of a planned community. 3. Encouraging a more creative and efficient approach to the use of the land. 4. Encouraging the preservation and enhancement of desirable site characteristics, natural features, and open space. 5. Encouraging a development pattern that is consistent with land use density, transportation facilities and community facilities objectives of the Comprehensive Plan. BACKGROUND/HISTORY In 2021, the applicant proposed a Comprehensive Guide Plan Amendment to change the land use designation of the subject site from LD, Low Density, to O/S, Office/Service. On October 15, 2021, the City Council directed the proposal be forwarded to the Metropolitan Council for review. The Metropolitan Council approved the land use amendment on November 30, 2021, and returned it to the City for implementation. The land use amendment will be forwarded to the City Council for action at the same time as the Rezoning and Preliminary Planned Development (PD) requests. The property was platted in 1947 and is zoned R-1, Single Family Residential. The Comprehensive Guide Plan designates the property for LD, Low Density residential use. The property contains an existing single-family residence on the east side of the site that was constructed in 1952. An attached garage and shop were added in 1960 and the shop was later converted to a porch entry area. A detached garage was added in 1980. The City approved Variances in 2006 to exceed the allowed number and square footage of detached accessory buildings, and to allow one accessory structure that does not have finish materials, roof pitch or roof style similar to the principal structure for the purpose of housing pigeons. The pigeon permit expired in 2020 and has not been renewed. Planning Report – Rivers of Life February 22, 2022 Page 3 EXISTING CONDITIONS The 1.93-acre property is located on the northwest corner of Pilot Knob Road and Highview Avenue. The site currently has driveway access onto Pilot Knob Road. Both water and sewer of sufficient size, depth, and capacity are available for extension and redevelopment of this property. A public trail is located along the west boulevard of Pilot Knob Road. Mature trees are located along the perimeter of the property and in the middle of the site. The majority of the site would be disturbed to extend utilities and construct the proposed building and parking lot. The site generally slopes to the northwest with elevations ranging from 907 to 897. SURROUNDING USES The site is surrounded on the south, east and west sides by single-family uses, zoned R-1, Single-family residential and guided Low Density (LD). To the north of the site is Children’s Therapy, zoned Neighborhood Business with an Office/Service (O/S) land use designation. EVALUATION OF REQUEST Description of Proposal – The applicant is proposing a land use amendment to allow redevelopment of the site with a 28-unit memory care and assisted living residence. The Office/Service land use designation upon which this proposal is predicated corresponds to the Limited Business zoning district, within which memory care housing is allowed as a conditional use (e.g. nursing home). The applicant describes the intended development in the submitted narrative. Rivers of Life provides 24-hour memory care. The building has a congregate dining room, activity/craft area and a secure outdoor area. The building is designed as a single-level building with 28 units, and the project is anticipated to provide about 35 full-time and part-time jobs. The site offers easy access for caregivers and families. The applicant states “our goal is to provide a good sense of community” and operations include members of the community coming to volunteer for music therapy, arts and crafts, reading activities or baking with residents. Compatibility with Surrounding Area – The proposed use is permitted in the LB, Limited Business zoning district, which is compatible with the pending Office/Service land use designation. Therefore, the LB zoning standards are the basis for evaluation of the proposed Planned Development. Planned Development zoning provides flexibility in the strict application of typical zoning standards allowing for greater creativity in site design to encourage preservation of natural features and more efficient use of the land. Applicant’s Narrative – The applicant’s narrative discusses refinements to the development plan that have been made since the initial concept provided with the earlier Comprehensive Guide Plan Amendment. These include access design, an increase in the building footprint and reduction in the number of planned units from 32 to 28, tree preservation efforts, site design Planning Report – Rivers of Life February 22, 2022 Page 4 and architectural building design considerations, and parking needs. Proposed deviations include a detached trash enclosure, reduced pavement setback from Highview Avenue, and a building coverage ratio exceeding 20 percent. Public Benefit – The stated public benefit is that the proposed redevelopment fulfills a need in the community and supports an aging population. “We will generate a strong tax base for the community, create about 35 full and part time jobs while maintaining a soft use with low traffic for the area.” The applicant states the proposed use is transitional between the lower density residential uses and the county road and commercial use to the north. In addition, Rivers of Life indicates they bring a sense of community by welcoming volunteers. Airport Noise Considerations – The City of Eagan considered airport noise as a factor in its Comprehensive Land Use Guide Plan and has adopted an Aircraft Noise Zone Overlay District in the land use regulations of the City Code. The Overlay District is in accordance with the Metropolitan Council’s Transportation Policy Plan and Land Use Compatibility Guidelines for Aircraft Noise. New construction as defined within these regulations is subject to noise attenuation requirements to limit negative impacts of aircraft noise within established noise zones. The current noise policy contours place this site within Noise Zone 4, within which the proposed use is considered to be conditional. As such, the use must meet structural performance standards to achieve a 19 dBA reduction in interior noise levels, and also the land use compatibility guidelines set forth by the Metropolitan Council’s Land Use Compatibility Guidelines for Aircraft Noise. To approve such development in this area, the City Council would need to make acceptable findings concerning the following: 1. Indoor sound level: The proposed construction design will provide outdoor to indoor attenuation required by structure performance standard. Architectural designs and construction methods for new construction would be required to incorporate sound attenuation standards to achieve an inside noise level reduction of at least 19 dBA. 2. Location: Located under major departure flight track used by jets. The site is located approximately two miles southeast of the nearest runway, which is used primarily for arrivals. 3. Location: Located parallel to primary runway used by jets. The site is not located parallel to a primary runway used by jets. Planning Report – Rivers of Life February 22, 2022 Page 5 4. Location: Located parallel to runway to be used for unshielded engine run-ups. The site is not located parallel to a primary runway used for unshielded engine run-ups. 5. Planning Considerations: Consistent with adjacent land use ambient noise; consistent with the overall comprehensive plan. The subject site is located adjacent to residential and commercial uses, and adjacent to a principal arterial roadway. 6. Method of Disclosure: Local government has adopted effective method to inform future occupants of aircraft noise exposure (notice in property deed, truth in housing, informational bulletin, and permit notice). The Airport Noise Zones are indicated in the City’s Land Use and Zoning Maps and both are available for viewing on the City’s web site. This will serve as notice to future occupants of the potential noise from aircraft operations. Lots – The lot dimensions are 280 feet by 300 feet, with an area of 1.93 acres. Site Plan – The proposed building is L-shaped and situated in the west and north portion of the site, with access from Highview Avenue at the southwest corner and parking along the east side. A monument sign is proposed on the southeast corner adjacent to the street intersection. The floor plan shows units around the perimeter of the building with the common and service areas for the building such as kitchen, dining, and laundry are located on the interior of the building. A detached trash enclosure is located off the southwest corner of the building and is accessed from the driveway. A stormwater infiltration basin is located in the southeastern portion of the site. The proposal includes deviations to building coverage, pavement setback and to allow a detached trash enclosure. Conforming Plan – A conforming site plan shows how the site could develop if all zoning standards are strictly applied. As compared to the proposed PD site plan, the conforming plan results in a smaller building with fewer units, less site disturbance and no outdoor patio area. The largest difference is that the conforming plan is only able to accommodate 18 units as compared to 28 units in the proposed PD plan. Setbacks – Typical structure setbacks for LB zoning district are 50 feet from the Pilot Knob Road (a principal arterial roadway), 30 feet from Highview Avenue (a local street), 20 feet from the north (rear) lot line, and 30 feet from the west (side) lot line which abuts property guided and zoned for residential use. Typical parking setback from public right-of-way is 20 feet. Planning Report – Rivers of Life February 22, 2022 Page 6 Proposed structure and parking setbacks are as follows: o Front Yard/Public Right-of-Way: The northern portion of the building is set back 50 feet from the Pilot Knob Road right-of-way, with the majority of the building exceeding the 50-foot setback. On the south side, the building is set back more than 30 feet from Highview Avenue right -of-way. The detached trash enclosure is set back 30 feet from Highview Avenue and 20 feet from the west side lot line. o Side Yard: The building is set back 40.6 feet from the west side lot line, exceeding the typical minimum setback of 30 feet from residential property. A retaining wall is located 28 feet from the west lot line. o Rear Yard: A 20-foot rear yard setback is typically required when the development site is not adjacent to residential. The proposed building satisfies the 20-foot rear yard setback. The north corner of the patio is set back 16 feet from the property line, and screening for the ground mechanical equipment is set back approximately 11 feet from the property line. Parking – Parking stalls are 10 feet wide by 19 feet long, with a 24-foot wide drive aisle, and satisfies the dimensional standards in the City Code. City Code sets minimum parking requirements for special residential facilities. The proposed use provides 28 memory care and assisted living units. According to the submitted narrative, none of the residents drive, so parking is needed for staff and visitors. The proposed use is comparable to a nursing home, for which the parking standard is at least one stall for each six beds plus one stall for each 15 beds. Thus, required parking for the proposed 28-unit facility, would be 6.5 stalls. The site plan provides 21 stalls, with one of those stalls designated accessible. Green Space – The zoning ordinance requires a minimum of 30 percent green space. The proposed site plan provides 45 percent green space. Building Coverage – The LB zoning ordinance allows a 20 percent building coverage ratio. The proposal is for 28.4 percent building coverage. This is a deviation to the typical City Code standard. The applicant’s narrative indicates the larger footprint is due to site configuration and the building being angled to best fit on the site and move parking to the “front” of the property. Further, because “residents have dementia we need to have a one level building for circular flow and to have the most efficient staffing ratios to cover residents.” The narrative states a two-story building would require an elevator which is difficult for residents with dementia to use and the one-level building is critical to “maintaining staffing ratios and have the programming our residents desire.” Structure Height – The LB zoning district allows a maximum structure height of 30 feet. Building height is measured from average grade to the mean roof level on a pitched roof. Using this Planning Report – Rivers of Life February 22, 2022 Page 7 measure, the proposed building is 16 feet 8 inches in height, and measures 26.5 feet to the roof peak. Building Architecture and Design – Buildings greater than 40 feet in length must have multiple planes or sections of coordinating materials to provide visual relief every 40 feet, and all sides of the building must have an equally attractive or the same finish. These standards appear to be satisfied. The proposed one-story building has a pitched roof. The exterior walls are finished with cement-based lap and shingle siding, simulated stone veneer, and glass windows and asphalt shingles. Exterior Building Materials – The zoning ordinance requires the use of at least two Class I materials comprising at least 65 percent of the building and not more than 35 percent Class II and III materials. Glass is a Class I material, while manufactured stone is a Class II material and cement-based siding is a Class III material. All four facades are identified as having similar architectural treatment. However, a majority of the building is finished with Class II (simulated stone) and Class III (cement-based siding) materials and does not meet the zoning standard of 65 percent Class I materials. The applicant’s narrative indicates the building design is intended to be residential in character and the proposed lap and shingle siding and pitched asphalt shingle roof. The applicant should modify the exterior finish to use a natural stone or brick product in place of simulated stone, and reduce the amount of cement based siding to achieve the zoning standard of 65 percent Class I materials. Revised building elevation plans conforming to the zoning standard should be provided with the Final Planned Development. Trash Storage – The trash enclosure should be designed consistent with City Code standards, large enough to contain all trash and recycling receptacles, at least six feet in height, with opaque gates. The proposed enclosure is shown to have the same exterior finish as the principal building, and includes a roof that matches the building architecture. Setback standards for the trash enclosure are the same as for the principal building. The trash enclosure is set back 20 feet from the west property line, a deviation to the 30 feet required. The detached trash enclosure is a deviation to typical City Code standards which require enclosures to be attached in commercial zoning districts. The enclosure is located adjacent to the building and its placement is due in part to the driveway location being as far from the street intersection as possible and to accommodate maneuvering space for trash hauler access. Mechanical Equipment – No rooftop mechanical equipment is proposed. Ground mounted mechanical equipment must be screened by a fence or wall, or opaque landscaping. Ground- mounted mechanical equipment is proposed in two locations, on the north side of the building and at the southwest corner. Both areas are proposed to be surrounded by a screen wall. Detailed design for the screen walls should be provided with the Final Planned Development. Planning Report – Rivers of Life February 22, 2022 Page 8 Signage – A monument sign is proposed at the southeast corner of the site and is set back the required 20 feet from each property line, exceeding the minimum 10-foot setback. Detailed design for the monument sign was not provided. City Code standards for monument signs set a maximum height of four feet for the sign message area, and 7 feet for the total sign structure. The submitted building elevations show one signage above the main entrance on the southeast elevation. All signage should be subject to City Code standards, and a Sign Permit should be obtained prior to installation of any signs. Site Lighting – The City Code requires that lighting be provided for safety, security and site circulation, and that illumination be downcast and shielded. The source of light also should not be visible from off the property. The preliminary site lighting plan appears acceptable. Wall mounted accent lights illuminate the building doorways, walkway and patio area. Parking lot lighting is proposed with LED fixtures on 27-foot poles. Illumination levels throughout the parking lot achieve the typical minimum standard of 0.5 footcandles and do not exceed 1.0 footcandle at the property line. The average to minimum ratio within the parking and drive areas is also less than 4.0 footcandles, indicating acceptable light uniformity. Topography/ Grading - This site is currently developed with a single-family home that has driveway access onto Pilot Knob Road. There are mature trees along the perimeter of the property, and in the middle of the site. The majority of the site would be disturbed to extend utilities and construct the proposed building and parking lot. The site generally slopes to the northwest with elevations ranging from 907 to 897. The preliminary grading plan is acceptable. A detailed grading, drainage, erosion, and sediment control plan should be prepared in accordance with current City standards and codes prior to final subdivision approval. All erosion/ sediment control plans submitted for development and grading permits should be prepared by a designer who has received current Minnesota Department of Transportation (MNDOT) training, or approved equal training as determined by the City Engineer in designing stormwater pollution prevention plans. Also, all personnel responsible for the construction and management of erosion/ sediment control devices, and the establishment of vegetation for the development, should have received Erosion/Sediment Control site management certification through the University of Minnesota, or approved equal training as determined by the City Engineer. Erosion control measures should be installed and maintained in accordance with City code and engineering standards. Storm Drainage – The entire site lies within Drainage District H (as designated in the City Storm Water Management Plan – 2007). Storm water currently flows overland to the northwest where it enters a ravine and that outlets to the Minnesota River. The proposed improvements would include a private storm sewer system that would capture the drainage from the building and parking lot and direct it to an infiltration basin along the east side of the site. Overflow from the Planning Report – Rivers of Life February 22, 2022 Page 9 infiltration basin would connect to the existing storm sewer stub at the northeast corner of the site. Wetlands – No wetlands are present on the site, therefore, City Code Section 11.67, wetland protection and management regulations, does not apply. Stormwater Management/ Water Quality – The applicant proposes to construct new/fully- reconstructed impervious surfaces totaling 1.05 acres, with additional areas of disturbed/graded soils that are to be revegetated, on the site. This development will need to comply with the City’s Land Disturbance Stormwater Pollution Prevention and Post- Construction Stormwater Management Requirements (City Code Section 4.34) for stormwater management and surface water quality, including Runoff Rate Control and 1.1-inch Volume Control. To meet the 1.1-inch Volume Control requirement for this development proposal, based on 1.05 acres of impervious surface, a minimum of 4,205 cubic feet of effective retention or water quality equivalent will need to be provided (if included with an acceptable Soil Management Strategy for any disturbed/graded areas proposed to be revegetated, to restore soil permeability and soil health). The applicant proposes to meet City stormwater rate control and volume control requirements through the on-site construction of one stormwater infiltration basin, with three pre-treatment sump structures, for rate control and volume control with a total retention volume/water quality equivalent of 4,454 cubic feet. No soil borings have yet been provided to verify if sub- soils can infiltrate. Overflow from the stormwater management system would discharge into the public storm sewer system within the Yankee Doodle Road right-of-way and discharge into public waterbody HP-1 within the Minnesota River Valley. Eagan Water Resources has reviewed the applicant’s submitted plans and stormwater management report, and finds the proposed plans meet City Code Section 4.34 Post- Construction Stormwater Management Requirements with the following conditions to provide: • appropriate erosion and sediment control during the site clearing and construction stages across the site during the extent of all construction activities (including effective rapid stabilization protections, construction stormwater treatment and sedimentation containment, rapid cleanup of tracking, etc.) to protect downstream waterbodies; • appropriate sub-soil exploration and evaluation to ensure that sub-soils are suitable for the infiltration of stormwater; • appropriate design and implementation of the infiltration basin; • appropriate inspection and maintenance access for the infiltration basin; • appropriate pre-treatment structures upstream of any stormwater basin inlet, for sediment/debris collection and easy cleanout accessibility; • adequate protection of the infiltration basin during installation through site full stabilization; Planning Report – Rivers of Life February 22, 2022 Page 10 • assurances of long-term recurring maintenance of all private stormwater management facilities; and • effective soil loosening and amendment of all graded soils to be revegetated. Sanitary Sewer/ Water Main – The preliminary utility plan is acceptable, with modification. The existing residential water and sewer services are too small for a commercial development so they will be abandoned and replaced with larger services. Lateral water main and sanitary sewer of sufficient size and capacity is located under Highview Avenue to the south and are available for connection. The utility connection will require open cutting the street, and the applicant should restore the boulevard, curb and gutter, and street in a manner acceptable to the City Engineer. The applicant should obtain a separate right-of-way permit from the City for any work within the Highview Avenue right-of-way. This development will also need to meet hydrant spacing and locations in accordance with City Fire Department and Public Works standards. It appears the hydrant coverage does not meet spacing requirements at the northwest corner of the building. Streets/Access/Transportation – The site is fronted by two public streets, Pilot Knob Road and Highview Avenue. For safety and mobility purposes, the two existing accesses onto Pilot Knob Road will be removed and a new commercial access will be constructed at the west end of the site onto Highview Avenue. The new driveway has two 90-degree turns and a 42-foot diameter cul-de-sac at the front entrance. The applicant provided turning templates that show the Fire Department’s largest fire truck can adequately circulate the site. A public trail is currently located along the Pilot Knob Road. The applicant is proposing to construct a sidewalk connection to the trail at the north end of the site. Due to the limited space available on the site, the applicant should provide a contractor parking and staging plan in a manner acceptable to the City Engineer, prior to approval of any land disturbing activities. The adjacent pedestrian trail along Pilot Knob Road should remain open at all times with the exception of a short period of time where the existing driveways are being removed, which will be addressed in the right-of-way permit with Dakota County. All construction and/or silt fence should be installed on the back side of the trail and no closer than two feet from the edge of the trail. Between November 1 and April 1, all fencing should be located at least five feet from the back side of the trail and back of curb. Easements/Right-of-Way – No drainage and utility easements currently exist on the parcel. The applicant should dedicate standard drainage and utility easements around the perimeter of the property in a form acceptable to the City Attorney. Adequate right-of-way is available along Highview Avenue. Pilot Knob Road is currently a four- lane undivided roadway with 50 feet of half right-of-way. Dakota County’s long-term plan Planning Report – Rivers of Life February 22, 2022 Page 11 anticipates Pilot Knob Road being widened to a four-lane divided roadway, which will require 75 feet of half right-of-way. Since the property is not being re-platted, this development will not be reviewed by the Dakota County Plat Commission. The county will need to acquire additional right of way if/when the road is widened. The applicant will need to obtain a right-of-way permit from Dakota County prior to any work being performed in County right-of-way. The development should be responsible for the acquisition of all regulatory agency permits required by the affected agency prior to the issuance of a building permit. Landscaping – The landscape ordinance sets standards for screening and buffering of parking, equipment and service areas. In addition, the ordinance establishes a benchmark for investment in landscaping of three percent of the building value. The landscape ordinance also allows credit for natural areas preserved in the site design, and the proposed development endeavors to preserve many of the existing trees along the west and north sides of the property. The proposed Landscape Plan is acceptable with some modifications. In general, the proposed plan appears to provide a variety of trees, with appropriate foundation plantings around the building and monument sign. Ornamental trees and a row of shrubs are proposed along the east side of the parking lot. Plant selection and placement does not appear to provide the typical level of required screening between the parking area and public right-of-way, which is a three-foot height with 75 percent opacity at maturity. For the Final Planned Development, the Landscape Plan should be revised to provide better landscape screening of the parking area, and to label all plant materials by type and quantity rather than solely relying on the graphic depiction. In accordance with City Code, a financial guarantee for landscaping should be provided with the Building Permit, the landscape guarantee is held for two years following satisfactory installation. Tree Preservation – This development application is subject to conditions of the City of Eagan Tree Preservation Ordinance. For this, single lot commercial application, the allowable significant tree removal limit is set at 30 percent. The tree inventory submitted with this application indicates 113 significant trees are currently on the site. Of this amount, significant tree impacts will result in the removal of 27 significant trees (22 percent of the total). Removal levels less than the allowable minimums do not require mitigation. However, in this submittal, there are some remaining conflicts between critical root zones (CRZs) and encroachments by excavation and grade limits where additional mitigation may be incurred. Significant encroachments exist along the east and northern property boundary. Per the Planning Report – Rivers of Life February 22, 2022 Page 12 ordinance, no grade change, construction activity, or storage of materials shall occur within the CRZ area, and tree protective measures are required to be installed. Acknowledgement of the CRZs is illustrated on the Tree Preservation Plan but no corresponding concessions are shown that confirm adherence to this standard. If encroachments are unavoidable, the applicant may either consider those trees for removal and adjust the mitigation amount accordingly, or the applicant may submit a long-term tree survival plan prepared and implemented by a professional arborist. The applicant should submit a revised Tree Preservation Plan and tree data table that illustrates adherence to the above requirement and recalculate mitigation as necessary. Any resulting tree mitigation should be fulfilled via on-site tree planting to the extent possible. If tree mitigation cannot fit on site, a cash dedication of the balance will be required. In addition, a performance Guarantee should be provided from the applicant to ensure the preservation of all significant trees located within 15 feet of the grade limit/construction zone. Financial Obligation – At this time, there are no pending assessments on this parcel. Based upon a study by City staff of the financial obligations collected in the past and proposed use for the property, the following estimated charges will be collected at time of building permit or connection to the City’s utility system. The final charges will be computed using the rates in effect at time of connection or permit. Improvement Rate Quantity Amount Watermain - Trunk $4,015.90/acre 1.93 acres $7,750.69 Sanitary Sewer - Lateral $45.40/F.F. 430 F.F. $19,522.00 Total $27,272.69 Parks and Recreation – The City Council recognizes it is essential to the health, safety and welfare of the residents of Eagan, persons working in Eagan and visitors to Eagan that the character and quality of the environment be considered to be of major importance in the planning and development of the City. In this regard, the manner in which land is developed and used is of high priority. The preservation of land for park, playground and public open space purposes as it relates to the use and development of land for residential, commercial/industrial purposes is essential to maintaining a healthful and desirable environment for all citizens and visitors of the City. It is recognized by the City Council that the demand for park, playground and public open space within a municipality is directly related to the density and intensity of development permitted and allowed within any given area. Urban type developments mean greater numbers of people and higher demands for park, playground and public open space. Use of Parks Dedication dollars is coordinated by City staff and approved by City Council to benefit the Park Service area, quadrant of the city and city-wide park system. Planning Report – Rivers of Life February 22, 2022 Page 13 The subject parcel is located within Park Service Area 4. This Service Area does have one existing neighborhood park, Highview Park. Highview Park is located at 1435 Skyline Road approximately one-quarter mile from the subject site. The subject site is also located approximately one mile north from the Central Park/Eagan Community Center campus. There is an adjacent trail located on Pilot Knob Road which provides a connection to the neighborhood parks within the Service Area and the city-wide trail system. In addition, portions of Fort Snelling State Park reside in Park Service Area 4, which provides passive recreation and trails. In combination, the parks contain a wide variety of amenities that are accessible via connected segments. Park and trail dedication have not been previously satisfied for this property. With redevelopment and the change in use, cash park and trail dedication will be due with the building permit. The 2022 rate for park dedication is $1,057 per 1,000 square feet of building area, and $1,451 per net acre for trail dedication. SUMMARY/CONCLUSION In summary, the applicant is requesting approval of a Rezoning and a Preliminary Planned Development to construct a one-story 28-unit memory care and assisted living facility upon approximately 1.93 acres located on the northwest corner of Pilot Knob Road and Highview Avenue. The proposal is consistent with the pending Office/Service land use designation, which was previously reviewed by the Advisory Planning Commission and City Council, and has received approval from the Metropolitan Council. The land use amendment remains pending and will be presented to the City Council for implementation concurrent with the Rezoning and Preliminary Planned Development. The proposed Planned Development zoning is in lieu of a conditional use permit for the use and to allow the use within the Aircraft Noise Overlay District Zone 4. The PD zoning also affords flexibility to typical zoning standards for better site design and mutual benefit. The proposed Preliminary PD includes deviations to building coverage, pavement setback and for detached trash storage. Site constraints include two street frontages and restricted locations for driveway access. Some modifications and additional details to the plans are requested for the Final Planned Development. The acceptability of the proposed Planned Development is a policy matter for city officials. ACTION TO BE CONSIDERED To recommend approval of a Rezoning from R-1, Single-family to PD Planned Development upon property located at 2811 Pilot Knob Road, legally described as Lot 1, Highview Acres. Planning Report – Rivers of Life February 22, 2022 Page 14 To recommend approval of a Preliminary Planned Development to allow a 28-unit memory care and assisted living facility upon property located at 2811 Pilot Knob Road, legally described as Lot 1, Highview Acres. If approved, the following conditions shall apply: 1. A Preliminary Planned Development Agreement shall be executed and recorded against the property at the Dakota County Recorder’s office. The Preliminary PD Agreement shall contain the following plans: • Preliminary Site Plan • Preliminary Building Elevations • Preliminary Landscape Plan • Preliminary Site Lighting Plan • Preliminary Signage Plan 2. A Final Planned Development Agreement shall be required prior to issuance of a Building Permit. The following plans are required for the Final Planned Development Agreement and shall be consistent with the approved Preliminary Planned Development: • Final Site Plan • Final Building Elevations • Final Landscape Plan • Final Site Lighting Plan • Final Signage Plan 3. The Planned Development shall have a term of three (3) years. 4. This Preliminary Planned Development approves a one-story assisted living and memory care facility with 28 units. 5. The building exterior shall conform with City Code standards which require at least two Class I materials comprising at least 65 percent of the building and no more than 35 percent Class II and Class III materials. 6. The trash enclosure shall be designed consistent with City Code standards in compliance with City Code Section 11.70 Subd. 21.D.7. 7. All signage shall be subject to compliance with the City Sign Code standards, and a Sign Permit shall be obtained prior to installation of any signs. 8. Site lighting shall be provided in conformance with City Code standards. Fixtures shall be downcast and shielded so the source of light is not visible from off the property, Planning Report – Rivers of Life February 22, 2022 Page 15 illumination throughout the parking lot should be not less than 0.5 footcandles and shall not exceed 1.0 footcandle at the property line. 9. All erosion/sediment control plans submitted for development and grading permits shall be prepared by a designer who has received current Minnesota Department of Transportation (MNDOT) training, or approved equal training as determined by the City Engineer in designing stormwater pollution prevention plans. Also, all personnel responsible for the installation of erosion/ sediment control devices, and the establishment of vegetation for the development, shall have received Erosion/Sediment Control Inspector/Installer certification through the University of Minnesota, or approved equal training as determined by the City Engineer. 10. This development shall comply with Eagan’s Land Disturbance Stormwater Pollution Prevention and Post-Construction Stormwater Management Requirements (City Code Section 4.34) for stormwater management and surface water quality, including land disturbance requirements, and Runoff Rate Control and 1.1-inch Volume Control of effective retention of the site’s impervious surface area (including effective soil remediation for all of the site’s disturbed soils that are to be revegetated). 11. Prior to receiving City approval to permit land disturbing activity, the applicant shall provide to the City with soil borings equally spaced within the footprint of any proposed infiltration feature, extending a minimum of 10 feet below the bottom of the proposed infiltration excavation with continuous sampling, to evaluate and ensure suitability for infiltration of stormwater, including, but not limited to, depth to saturated soils and P200 analysis if SM soils are encountered below the excavation extent. A minimum of three (3) soil borings must be provided within the footprint of the proposed stormwater infiltration basin. If the soil boring logs indicate incompatibility of existing sub-soil permeability, or shallow groundwater conflict, with the submitted and reviewed design plans for meeting volume control requirements, the applicant shall revise the design and/or construction plans to ensure water quality equivalent of volume control requirements are fully met for the mitigated impervious drainage area, to the satisfaction of the City Engineer. 12. The applicant shall provide adequately sized pre-treatment structures (e.g. 4-foot minimum depth sump, 5-foot minimum diameter, with floatable skimmer hood) at, or immediately upstream of, any stormwater infiltration facility inlet to provide for effective capture and easily-accessible cleanout of fine-sand sized particles and floatable pollutants. Pre-treatment structures shall be accessible by appropriate maintenance equipment. Details shall be included in applicable plan sheet(s) using Eagan Standard Detail Plate E231. 13. Prior to receiving city approval to permit land disturbing activity, the applicant shall provide construction details of the proposed infiltration basin following MPCA Planning Report – Rivers of Life February 22, 2022 Page 16 Minnesota Stormwater Manual Standards & City Engineering Standards for Infiltration Basins for City review/acceptance by the City Engineer and include in construction plans. Construction details shall include infiltration basin cross-sections, construction/protection/inspection notes, infrastructure components involved, sub- soil testing/loosening, soil media specifics, and planting/stabilization specifics, to ensure infiltration practices are properly designed, constructed, planted, and adequately protected during / after construction to prevent clogging, and able to be properly maintained to function as intended. Infrastructure details shall be included for stable inlets, outlets and emergency overflows and unobstructed access for inspections and maintenance of inlets/outlets. Details for basin soil requirements shall include sub-soil infiltration testing for the infiltration basins following City/MPCA guidelines, sub-soil ripping of 18-inch depth minimum x 18-inch maximum spacing at over-excavation prior to soil amendment backfilling, and appropriate soil amendment criteria. Details for planting and stabilization requirements shall include live planting at 18-inch on-center spacing of all basin bottom area, seeded or live-planted side- slopes, and permanent erosion-control details for basin bottom and side-slopes, etc. These graphical details and notes shall be prominently included in all applicable plan sheets (e.g. Grading Plan, Utility Plan, Details, etc.). Notes shall be provided that grading and utility contractor(s) shall provide 24-hours advance notice to City Water Resources Staff of any grading or utility work involving the proposed infiltration basin, including installation of all inlets and outlets, including contact email and phone number for City Water Resources Staff. 14. During infiltration system over-excavation/sub-soil work, the applicant shall ensure that a Certified Soil Scientist will be present to verify and document that practice area sub-soils are suitable for a saturated-state infiltration rate of no less than 0.7-inches per hour (based on 0.35-inch per hour design rate with 2x safety factor) or greater (but less than 8.0-inch per hour). If the sub-soil infiltration rates are less than 0.7- inches per hour (or greater than 8.0-inch per hour), the applicant shall immediately notify the City Engineer and revise the volume control practice(s) design and construction as necessary (e.g. over-excavation/soil-amendment depth, etc.) to ensure volume control requirements are fully met. Verification of sub-soil infiltration testing rates shall be provided immediately to the City of Eagan on the day of infiltration testing. The applicant shall ensure that the City Water Resources staff is provided 24-hour advance notice of the occurrence of infiltration verifications and also provided notice prior to any excavation and/or soil backfilling within the infiltration practices, to arrange for inspections. 15. Prior to receiving city approval to permit land disturbing activity, the property owner shall provide detailed Soil Management Strategies in the plan set for City review, and acceptance by the City Engineer, that provide graphical details and notes on soil protection/restoration in the Stormwater Management Plan and prominently included in all applicable plan sheets (e.g. Erosion & Sediment Control Plan, Grading Planning Report – Rivers of Life February 22, 2022 Page 17 Plan, Landscape Plan, etc.) and shall specify estimated quantities of soil ripping area and volume of compost to be imported and incorporated on pertinent plan sheet quantity tables. Prior to receiving a Certificate of Occupancy for any affected construction, Soil Management Strategy implementation documentation (e.g. haul tickets, representative on-site soil samples, compaction testing and soil organic content test results) shall be provided to City Water Resources staff to verify approved soil management strategy compliance. Notes shall be provided that implementing contractor shall provide 24-hours advance notice to City Water Resources staff prior to implementation of soil loosening and amendment. 16. Prior to proceeding with land disturbing activity, the Property Owner shall enter into a long-term stormwater management system maintenance agreement with the City, detailing the annual inspection and maintenance required to occur to ensure proper operation and performance of the private permanent stormwater management system, in a form acceptable to the City Attorney. 17. Before the city returns any Stormwater-related Performance Guarantee Fees on the development site, the applicant shall demonstrate that all stormwater management practices are performing as intended and shall provide the City Engineer as-built plans meeting City requirements for as-built standard submittals that demonstrate that all constructed stormwater conveyance structures, stormwater management facilities (sumps, infiltration basin, etc.), including soil loosening & amendment prior to landscaping, conform to design and/or construction plans, as approved by the City. Photos/video of final inspection of clean underground infiltration chamber gallery systems and contributing storm sewer shall be provided to the City Engineer. The applicant shall submit to the City Engineer certification that the stormwater management facilities have been installed in accord with the plans and specifications approved. This certification shall be provided by a Professional Engineer licensed in the State of Minnesota. 18. The street, curb and gutter, trail, and boulevard shall be restored in a manner acceptable to the City Engineer. 19. This development shall provide hydrant spacing and locations in accordance with City Fire Department and Public Works standards. 20. The applicant shall dedicate standard drainage and utility easements around the perimeter of the property in a form acceptable to the City Attorney. 21. The applicant shall obtain a separate right-of-way permit from the City for any work within the Highview Avenue right of way. 22. The applicant shall provide a contractor parking and staging plan prior in a manner acceptable to the City Engineer, prior to approval of any land disturbing activities. 23. All construction and/or silt fence shall be installed on the back side of the trail and no closer than two feet from the edge of the trail. Between November 1 and April 1, all fencing shall be located at least five feet from the back side of the trail and back of curb. 24. This development shall accept its additional financial obligations as defined in the staff’s report in accordance at the time of building permit. 25. This development shall dedicate adequate drainage and ponding easements, in accordance with requirements set forth in the latest version of the City’s Stormwater Management Plan. 26. The development shall be responsible for the acquisition of all regulatory agency permits required by the affected agency prior to the issuance of a building permit. 27. The applicant shall submit a revised tree preservation plan and tree data table that rectifies critical root zone encroachments and recalculates mitigation as necessary. Should mitigation be required, the applicant shall also submit a Tree Mitigation Plan showing the fulfillment of the required tree mitigation for approval prior to Final Planned Development or Final Subdivision. The Tree Mitigation Plan shall show the number of, size, and species of all required mitigation trees in plan form as well as tabular form. Mitigation trees are in addition to landscape requirements and shall be labeled as such on an overall Landscape and Tree Mitigation Plan. If required mitigation trees cannot fit on site, the balance of mitigation shall be provided as cash payment as identified in the City’s Fee Schedule. 28. Tree protective measures shall be placed at the drip line or at the perimeter of the Critical Root Zone (CRZ), whichever is greater. If tree protection fencing cannot be placed and maintained at the required distance from preserved trees, then either a) these trees shall be considered as removed; or b) a Tree Health Management Plan prepared by a certified arborist shall be provided indicating tree management activities to be implemented that will ensure the survival of these trees. 29. In accordance with the Tree Preservation Ordinance, a Performance Guarantee shall be provided in the amount of $25.00 per diameter inch to ensure the preservation of all significant trees within 15 feet of the construction zone. 30. The applicant shall contact the City Forestry Division and set up a pre-construction site inspection at least five (5) days prior to the issuance of the Grading Permit to ensure compliance with the approved Tree Preservation Plan and placement of the Tree Protection Fencing. C.S.A.H. NO. 31 (PILOT KNOB ROAD)EAGAN INDUSTRIAL ROAD BU RNSID E AVENUEPOPPLER LANEE G A N A V E N U E LOON LANEBRIDGEVIEW AVE STEPHANIE CR EAGANDALE BOULEVARDCORP. CENT. DR. HIGHVIEW AVE CORPORATE CENTER DRIVE VILASLANES KYLIN E CT EAGA N D A LEPLACEINTERSTATE HWY. NO. 35ETOWERVIEW ROAD TOWERVIEW ROAD EAGANDALEBLVDOSTER DR R A I N I E R LANE DRIVE HIGHVIEW TERRACESIBLEY HILLS DRVINCE TR CENTERCOURTBEAMLANEEAGANDALE BLVDBRIDGEVIEW TERRACEPINERIDGEDRIVESKYLINETR C.S.A.H. NO.26 (LONE OAK ROAD)WO: 52497EAGA N D A LE CT AVALON AVENUE SKYLINE DRIVEHIGHRIDGEWOODLARK LANEINTERSTATE HWY. NO. 494 TRAPP ROAD EGANAVENUEM C C A R T H Y R O A D BURNSIDEAVENUETERRACESTATETRUNKHWY.NO.13SOUTHRIDGE AVE RED CEDAR ROAD FAI R L A WN P L A C E INLANDROADSHIELDSDR.C ORPORATE CENTER CUR V E RUSTICHILLSDRWESTSERVICE ROAD SKYLINECHERRYWOOD CTMCCART H Y R D SKYLIN E R OAD PATH HIGHVIEW AVE EA G A N IN D U STRIAL R O A D SKYLINE DR PilotKnob Park CountryHome Park Highview Park Fort SnellingState Park Location Map 0 1,000500 Feet ´ §¨¦35E §¨¦494 Cliff Rd Diffley Rd Yanke e Do odle Rd Lone Oak Rd Map Area Extent Project Name: Rivers of LifeRequest: Rezoning and Preliminary Planned DevelopmentFile Nos.: 04-RZ-01-01-22 04-PD-01-01-22Subject Site CO. RD. 31 Pilot Knob RoadCO. RD. 31 Pilot Knob RoadHighview Av e Vilas LaneBeam LaneCorporate Center Curv e Avalon Avenue Avalon Avenue 0 500250 Feet ´ This map is for reference use only. This is not a survey and is not indtended to be used as one. Aerial photo-Spring 2021 Project Name: Rivers of LifeRequest: Rezoning & Prelim. Planned DevelopmentFile Nos.: 04-RZ-01-01-22; 04-PD-01-01-22 CO. RD. 31 Pilot Knob RoadCO.RD.31PilotKnobRoadHighview Av e Avalon Avenue 0 15075 Feet ´ This map is for reference use only. This is not a survey and is not indtended to be used as one. Aerial photo-Spring 2021 Project Name: Rivers of LifeRequest: Rezoning & Prelim. Planned DevelopmentFile Nos.: 04-RZ-01-01-22; 04-PD-01-01-22 4m +9 m = 4 m + 9m =6'81/4-9+:(')16'81/4-9+:(')16'81/4-9+:(')16'81/4-9+:(')1(;/2*/4-9+:(')1(;/2*/4-9+:(')1(;/2*/4-9+:(')1(;/2*/4-°9+:(')1-.,-;.*<&;*3:*5.149034'74&)(4:39>89&9*&.)-.,-<&>34*8'/4'-+°'4*°;:/2/:?+'9+3+4:9°6+8°:.+°62':°5,)./2*8+49°:.+8'6?°'**/:/54'96.'2:°6':.='? )54)8+:+);8()54)8+:+);8()54)8+:+);8()54)8+:+);8()54)8+:+);8(81,7%8,/',1* VI 5 6,7( VI$'$75$6+&RS\ULJKW'-5$UFKLWHFWXUH,QF$&21)250,1*6,7(3/$1($*$1015,9(562)/,)(($*$1 35(/,0,1$5<3/$11(''(9(/230(17$33/,&$7,21 $6,7(1 MLAZGAR ASSOCIATES10340 VIKING DR.SUITE 150(p) 952-943-8080EDEN PRAIRIE, MN 55344(f) 952-943-8088www.mlazgar.comCommentsDate#RevisionsDate:2/2/2022Page M of 11. Standard Reflectance of 80/50/20 unless noted otherwise2. Not a Construction Document, for Design purposes only3. Standard indoor calc points @ 30" A.F.F. unless noted otherwise4. Standard outdoor calc points @ Grade unless noted otherwise5. Egress calc points @ 0" A.F.F.6. Mlazgar Associates assumes no responsibility for installed light levels due to field conditions, etc.Scale: 1" = 16'SITE LIGHTINGRIVER OF LIFEEAGAN, MNDrawn By: BSRLMA Project #: 122076Calculation SummaryLuminaire ScheduleLabelCalcTypeSymbolQtyUnitsAvgLabelManufacturerDescriptionArrangementLum. LumensLum. WattsLLFMaxMinAvg/Min1SP1PRV-PA1A-740-U-T4W-HSSSingle542054Max/MinCalcPts_10.900IlluminanceFc0.305.20.0N.A.N.A.1SP2PRV-XL-PA3A-740-U-T2UPARKING LOTSingle246921720.900IlluminanceFc2.325.20.63.878.672SP3PRV-XL-PA3A-740-U-T4WSingle243251720.90018WMAFX LIGHTING LNNW0914MBBKSingle72610.770.900&+,/'5(1 67+(5$3<&(17(5$9$/21$9(18( %8,/',1*6(7%$&. 3$5.,1*6(7%$&.352326('6&5((1,1*:$//352326('0(381,76 75$16)250(5*(1(5$725'2$6 352326('6725<6(1,25/,9,1*)$&,/,7<))( %8,/',1*6(7%$&.5 5 7<3 5 3$5.,1*6(7%$&. 7<3 7<3 5 5 5 352326('75$6+(1&/2685(5 5 3$5.,1*6(7%$&. %8,/',1*6(7%$&. 352326('02180(176,*15 +,*+9,(:$9(18(6,7(/$<2873/$1 [3/$16+((7 6&$/( 352326('321'5 %8,/',1*6(7%$&. 3$5.,1*6(7%$&.352326('321'3,/27.12%52$'&6$+MH: 12SP1SP2MH: 27MH: 27SP3MH: 27SP3MH: 8WMWMMH: 8WMMH: 8WMMH: 8WMMH: 8MH: 8WMWMMH: 8MH: 8WMWMMH: 8WMMH: 8MH: 8WMWMMH: 8MH: 8WMWMMH: 8WMMH: 8WMMH: 8WMMH: 8WMMH: 80.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.2 0.2 0.2 0.2 0.2 0.2 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.3 0.3 0.3 0.3 0.2 0.2 0.2 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.4 0.5 0.4 0.4 0.3 0.3 0.3 0.2 0.2 0.2 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.2 0.3 0.4 0.5 0.4 0.3 0.3 0.3 0.5 0.7 0.8 0.8 0.7 0.6 0.6 0.5 0.6 0.6 0.5 0.3 0.2 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.2 0.7 0.8 0.8 0.9 0.9 1.1 1.2 1.3 1.5 1.9 2.7 2.1 1.7 1.7 1.6 1.5 1.3 1.1 0.8 0.5 0.2 0.2 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 1.8 1.4 1.3 1.2 1.2 1.5 2.0 2.6 2.8 3.4 4.4 3.8 3.2 3.1 2.6 2.2 1.8 1.5 1.2 0.6 0.3 0.2 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.2 3.1 2.3 1.8 1.2 1.2 1.6 2.3 3.2 3.5 3.5 3.6 3.7 3.9 3.9 3.1 2.5 2.0 1.8 1.5 0.7 0.4 0.2 0.2 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.4 4.2 3.7 2.2 1.2 1.2 2.0 2.7 3.8 4.6 4.8 5.1 5.1 5.2 4.6 3.6 2.9 2.5 2.3 2.0 0.9 0.4 0.3 0.2 0.2 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.4 4.3 3.8 2.1 1.2 1.6 4.0 2.8 3.5 4.4 4.7 5.2 5.0 4.7 4.2 3.5 3.0 2.8 2.6 2.4 1.0 0.5 0.4 0.3 0.2 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 3.1 2.3 1.7 1.0 0.2 1.5 1.9 1.9 2.4 2.5 2.6 2.6 2.6 2.6 2.6 2.6 1.1 0.6 0.5 0.4 0.3 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 1.7 1.2 0.91.0 1.4 1.9 2.3 2.7 2.5 2.8 2.8 1.5 0.9 0.7 0.5 0.3 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.6 0.6 0.50.7 1.1 1.7 2.4 3.2 3.0 3.6 3.5 2.6 1.4 0.9 0.7 0.4 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.2 0.20.7 1.0 1.7 2.4 3.3 3.4 4.3 3.8 3.2 1.9 1.2 1.1 0.5 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.10.9 1.0 1.6 2.3 3.1 3.0 3.7 3.6 2.6 1.8 1.5 1.5 0.7 0.2 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.02.6 1.2 1.6 2.1 2.6 2.7 3.1 3.3 2.1 1.8 1.9 2.0 0.8 0.2 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.02.6 1.2 1.4 1.7 2.1 2.6 3.1 3.4 2.2 2.0 2.1 2.2 0.9 0.3 0.2 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.02.3 1.1 1.2 1.4 1.7 2.3 2.9 3.5 2.6 2.1 2.2 2.3 1.0 0.5 0.3 0.2 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.02.1 1.0 1.0 1.2 1.5 1.9 2.6 3.2 2.9 2.5 2.9 2.9 1.9 0.8 0.3 0.2 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.8 0.8 0.8 1.0 1.2 1.6 2.3 2.9 3.1 3.0 3.6 3.2 2.7 1.3 0.3 0.2 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.7 0.6 0.7 0.8 1.0 1.4 2.0 2.5 2.9 2.7 3.1 3.0 2.3 1.0 0.3 0.2 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.01.6 2.1 0.7 0.7 0.9 1.2 1.7 2.1 2.4 2.2 2.4 2.5 1.2 0.6 0.3 0.2 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.01.5 1.8 0.9 0.7 0.9 1.1 1.5 1.8 1.9 1.9 2.0 2.2 0.8 0.3 0.2 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.03.2 1.6 2.6 1.2 1.3 1.5 1.6 1.6 1.6 1.8 2.0 0.7 0.2 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.01.8 2.8 3.3 3.4 1.9 1.8 1.5 1.4 1.5 1.6 0.7 0.2 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.01.1 1.1 0.5 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.0 0.00.9 0.8 0.4 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 1.01.7 0.9 0.3 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.2 0.21.6 0.5 0.3 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.21.2 0.3 0.2 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 1.50.0 0.9 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.2 0.40.5 0.2 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.2 5.20.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.4 0.2 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.00.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.011111111111111111111110.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.50.50.50.50.50.50.50.50.5PARKING LOTIlluminance (Fc)Average = 2.32Maximum = 5.2Minimum = 0.6Avg/Min Ratio = 3.87Max/Min Ratio = 8.67 Project Catalog #Type Prepared by Notes Date PS500005EN page 1 December 10, 2021 4:21 PM Quick Facts • Direct-mounted discrete light engine for improved optical uniformity and visual comfort • Lumen packages range from 4,300 - 41,000 nominal lumens (30W - 300W) • Replaces 70W up to 1,000W HID equivalents • Efficacies up to 148 lumens per watt • Standard universal quick mount arm with universal drill pattern Interactive Menu • Ordering Information page 2 • Product Specifications page 2 • Mounting Details page 3 • Optical Configurations page 3 • Energy and Performance Data page 4 • Control Options page 6 Dimensional Details Prevail XL Prevail Prevail Petite Area / Site Luminaire Lumark Prevail Discrete LED Connected Systems • WaveLinx PrevailPrevail Petite 13-15/16" [354mm] 26-13/16" [681mm] 2-3/4"[70mm] 6-15/16"[177mm] Prevail XL 17-7/8"[454mm] 39-5/8"[1006mm] 3-11/16"[94mm] 7-1/8"[180mm] 2-3/4"[70mm] 13-15/16"[354mm] 15-1/4"[386mm] 20-7/8"[531mm] 6-15/16"[177mm] Product Features LumenSafe Technology NOTES: 1. Visit https://www.designlights.org/search/ to confirm qualification. Not all product variations are DLC qualified. 2. IDA Certified for 3000K CCT and warmer only. Product Certifications 1 1 2 CLASS A CAN ICES-005 AVAIL A B L ECO MP L IA N T OPTIO NSBAABUY AMERICAN ACT Lennon Outdoor Sconce LNNW Series Features Offered in two versions. The 11” wiht an integrated photocell for dusk to dawn operations or the 14” with integrated photocell and motion sensor. Ideal use for security and general lighting in outdoor residential, commercial, and hospitality applications. Fixture mounts to a standard junction box (not included). Construction Die-cast aluminum construction. Standard mounting holes and hardware are included. Power supply connections must be made inside a junction box (not included). Finish Black powder coated finish. Diffuser Clear water glass diffuser. Electrical Medium base socket. Built-in photocell. Motion sensor (LNNW0914MBBK ONLY) Minimum starting temperature -4°F/-20° C Lamping For use with (1) 60W Max meduim base bulb (lamp not included). Sockets can be labeled for reduced wattage upon request. Certification All fixtures are cETLus listed for wet locations. Warranty Limited warranty: This fixture is free from defects in materials and workmanship for a period of 5 years from date of purchase. Specifications and dimensions subject to change without notice. 2345 N. Ernie Krueger Circle • Waukegan, IL. 60087 • P: 847.249.5970 • F: 847.249.2618 • AFXinc.com R0/21 DATELOCATION PREPARED BY COMMENTS CATALOG NUMBER QUANTITY FIXTURE TYPE Ordering Information: Black Qty. Lamp H W D LNNW0711MBBK 1 60W (MAX) 11" 7"9" LNNW0914MBBK 1 60W (MAX) 9"11"14" LNNW0711MBBK LNNW0914MBBK A2.0A5 A2.0 B3 A2.0 B1 A2.0 A4A2.0A3A2.0B2 A2.0 A1 A2.0A2 WATER METER UNIT 19 UNIT 17 UNIT 23 UNIT 21 UNIT 27 UNIT 25 UNIT 20 UNIT 24 UNIT 22 UNIT 28 UNIT 26 UNIT 18 UNIT 4 UNIT 9 UNIT 10 UNIT 11 I.T. UNIT 8 UNIT 6 UNIT 7 UNIT 5 UNIT 1 CONFERENCE UNIT 16 STORAGE NURSE COVERED PORCH WATER UNIT 15 UNIT 14 UNIT 13 UNIT 12 OFFICE UNIT 2 STORAGE STORAGELAUNDRY LAUNDRY UNIT 3 EAST DINING CORRIDOR CORRIDOR LIVING AREA CORRIDOR CORRIDOR LIVING AREA MAIN DINING LIVING AREA RECEPTION VESTIBULE NORTH DINING CORRIDOR ACTIVITY DESK LIVING AREA CORRIDORCORRIDOR LIVING AREA TLT TLT TOILET STAFF STOR. STORAGE CORRIDOR ELECTRICAL METER GAS METER EXTERIOR TRASH ENCLOSURE, SEE CIVIL TOTAL BUILDING 23,858 GROSS SF 13'-5 1/4" TYPICAL UNIT 332 NET SF TYPICAL UNIT 332 NET SF MECHANICAL EQUIPMENT SCREEN WALL OF SAME MATERIAL AS BUILDING MECHANICAL EQUIPMENT SCREEN WALL OF SAME MATERIAL AS BUILDING MECHANICAL EQUIPMENT SCREEN WALL OF SAME MATERIAL AS BUILDING MECH GEN MECH MECH MECH ELECTRICAL JAN. TUB ROOM SPA SUNROOM KITCHEN KITCHEN STORAGE Copyright 2021 DJR Architecture, Inc. A1.0 FLOOR PLAN EAGAN, MN RIVERS OF LIFE -EAGAN 21-092.00 2/2/2022 PRELIMINARY PLANNED DEVELOPMENT APPLICATION 3/32" = 1'-0"A1 FLOOR PLAN -LEVEL 1 N CEMENTITIOUS SHAKES CEMENTITIOUS LAP SIDING ASPHALT SHINGLES DECORATIVE SCONCES SIMULATED STONE VENEER SIGNAGE BY OTHERS APPROX. 30 SF CEMENTITIOUS SHAKES CEMENTITIOUS LAP SIDING ASPHALT SHINGLES DECORATIVE SCONCES SIMULATED STONE VENEER 17'-8" TO MID OF ROOFCEMEMTITIOUS LAP SIDING ON MEP SCREENING ROOFTOP CONDENSERS CONCEALED BY ROOF CEMENTITIOUS SHAKES CEMENTITIOUS LAP SIDING ASPHALT SHINGLES DECORATIVE SCONCES SIMULATED STONE VENEER CEMEMTITIOUS LAP SIDING ON MEP SCREENING ROOFTOP CONDENSERS CONCEALED BY ROOF CEMENTITIOUS SHAKES CEMENTITIOUS LAP SIDING ASPHALT SHINGLES DECORATIVE SCONCES SIMULATED STONE VENEER ROOFTOP CONDENSERS CONCEALED BY ROOF CEMENTITIOUS SHAKES CEMENTITIOUS LAP SIDING ASPHALT SHINGLES DECORATIVE SCONCES SIMULATED STONE VENEER CEMEMTITIOUS LAP SIDING ON MEP SCREENING ROOFTOP CONDENSERS CONCEALED BY ROOF CEMENTITIOUS SHAKES CEMENTITIOUS LAP SIDING ASPHALT SHINGLES DECORATIVE SCONCES SIMULATED STONE VENEER CEMEMTITIOUS LAP SIDING ON MEP SCREENING ROOFTOP CONDENSERS CONCEALED BY ROOF CEMENTITIOUS SHAKES CEMENTITIOUS LAP SIDING ASPHALT SHINGLES DECORATIVE SCONCES SIMULATED STONE VENEER MEP VENTING SHOWN SHADED, VERIFY W/ MEP CEMEMTITIOUS LAP SIDING ON MEP SCREENING CEMENTITIOUS SHAKES CEMENTITIOUS LAP SIDING ASPHALT SHINGLES DECORATIVE SCONCES SIMULATED STONE VENEER CEMEMTITIOUS LAP SIDING ON MEP SCREENING ROOFTOP CONDENSERS CONCEALED BY ROOF Copyright 2021 DJR Architecture, Inc. A2.0 EXTERIOR ELEVATIONS EAGAN, MN RIVERS OF LIFE -EAGAN 21-092.00 2/2/2022 PRELIMINARY PLANNED DEVELOPMENT APPLICATION 3/32" = 1'-0"A3 SOUTHEAST EXTERIOR ELEVATION (ENTRY) 3/32" = 1'-0"A1 EAST EXTERIOR ELEVATION A 3/32" = 1'-0"A2 SOUTH EXTERIOR ELEVATION A 3/32" = 1'-0"A4 EAST EXTERIOR ELEVATION B 3/32" = 1'-0"A5 EAST EXTERIOR ELEVATION B 3/32" = 1'-0"B1 WEST EXTERIOR ELEVATION 3/32" = 1'-0"B2 NORTHWEST EXTERIOR ELEVATION 3/32" = 1'-0"B3 NORTH EXTERIOR ELEVATION NORTH A Material Area Percent Stone 395sf 41.32% Fiber Cement Lap 206sf 21.55% Fiber Cement Shakes 119sf 12.45% Glazing 152sf 15.90% Door (HM)84sf 8.78% Total:956sf 100% EAST A Material Area Percent Stone 272sf 29.82% Fiber Cement Lap 340sf 37.28% Fiber Cement Shakes 97sf 10.64% Glazing 180sf 19.74% Door (HM)23sf 2.52% Total:912sf 100% NORTHEAST Material Area Percent Stone 138sf 14.44% Fiber Cement Lap 262sf 27.41% Fiber Cement Shakes 365sf 38.18% Glazing 191sf 19.98% Door (HM)0sf 0% Total:956sf 100% SOUTHWEST Material Area Percent Stone 430sf 25.87% Fiber Cement Lap 300sf 18.05% Fiber Cement Shakes 696sf 41.88% Glazing 209sf 12.58% Door (HM)27sf 1.62% Total:1662sf 100% WEST Material Area Percent Stone 512sf 38.44% Fiber Cement Lap 477sf 35.81% Fiber Cement Shakes 97sf 7.28% Glazing 246sf 18.47% Door (HM)0sf 0% Total:1332sf 100% SOUTH Material Area Percent Stone 716sf 40.27% Fiber Cement lap 608sf 34.20% Fiber Cement Shakes 97sf 5.45% Glazing 357sf 20.08% Door (HM)0sf 0% Total:1778sf 100% NORTH B Material Area Percent Stone 507sf 35.98% Fiber Cement Lap 489sf 34.71% Fiber Cement Shakes 97sf 6.88% Glazing 292sf 20.72% Door (HM)24sf 1.70% Total:1409sf 100% EAST B Material Area Percent Stone 479sf 48.24% Fiber Cement Lap 243sf 24.47% Fiber Cement Shakes 119sf 11.98% Glazing 152sf 15.31% Door (HM)0sf 0% Total:993sf 100% 3/32" = 1'-0"B4 TRASH ENCLOSURE FRONT 3/32" = 1'-0"B5 TRASH ENCLOSURE SIDE CEMENTITIOUS SHAKES - LIGHT GREY CEMENTITIOUS LAP SIDING - DARK GREY ASPHALT SHINGLES - BLACK SIMULATED STONE VENEER - ABSAROKA TUSCAN LEDGESTONE CEMENTITIOUS TRIM, FASCIA & SOFFITS -IVORY STOREFRONT -CLEAR ANNODIZED CEMEMTITIOUS LAP SIDING ON MEP SCREENING ROOFTOP CONDENSERS CONCEALED BY ROOF ALUMINUM FENCING Copyright 2021 DJR Architecture, Inc. A2.1 EXTERIOR ELEVATIONS EAGAN, MN RIVERS OF LIFE -EAGAN 21-092.00 2/2/2022 PRELIMINARY PLANNED DEVELOPMENT APPLICATION 1/8" = 1'-0"A1 SOUTH EXTERIOR ELEVATION 1/8" = 1'-0"A2 EAST EXTERIOR ELEVATION 1/8" = 1'-0"A3 WEST EXTERIOR ELEVATION 1/8" = 1'-0"A4 NORTH EXTERIOR ELEVATION 1/8" = 1'-0"B1 TRASH ENCLOSURE FRONT COLOR Copyright 2021 DJR Architecture, Inc. A3.0 EXTERIOR RENDERING EAGAN, MN RIVERS OF LIFE -EAGAN 21-092.00 2/2/2022 PRELIMINARY PLANNED DEVELOPMENT APPLICATION Rezoning Narrative: Zoning classification (existing and proposed) • Currently the site is being used as a single family residential home but our proposed use would be for a single story memory care/enhanced assisted living community. Our proposed use would be a Planned Development going forward. What you want to do; timing/phasing: • Our timing would be a mid-summer construction of 2022 with a completion of sometime summer/fall of 2023. Existing land uses on subject property: • Existing land use is single family residential What impact does the rezoning have on surrounding property and land uses? • To the north is a healthcare clinic and many commercial businesses along Pilot Knob Rd. because of the high traffic flow. Currently our use is surrounded by a medical clinic to the north, Pilot Knob to the east and only one residential home to the west. Our use would be a great buffer in the area and will help be a nice transition between the current medical office and the residential use which is surrounded by two streets, Pilot Knob and Highview Avenue. Previously we have had less than 12 emergency vehicle calls to date at other locations in one year because we have full-time and on-call nursing. Furthermore, none of the resident’s drive at our locations so traffic flow will be minimal with only needing about 22 parking spots. • Our proposed use would be eliminating an access point off of Pilot Knob per county recommendations. • We have addressed the city’s concern by approaching the neighbor to the north to see if their drive would work as an access point. This request was not favorable and due to the narrow drive and required ponding on the site, this option would not work. • Our current ingress design would push the ingress/egress off Pilot Knob Rd. and onto Highview as far west from the intersection as we can. Building design changes from preliminary submission to the city • Building size has increased from our initial concept plan, but the number of units has gone down from 32 to 28 units because of site constrictions and configuration of the building. • Moved the ingress/egress away from the intersection of Pilot Knob and Highview further west What impact does the rezoning have on the subject property? • The rezoning to planned development would be particularly appropriate due to the high traffic on Pilot Knob, the current medical user to the north and the site being nearly 2 acres in size. We believe that the rezone would serve as a complement the current user to the north and would maintain a great buffer to the residential neighbor to the west while maintaining a very residential feel with a single story building. The building would have soft roof lines and maintain a large tree buffer as most of the mature tree coverage that lines the perimeter of the property would be preserved on the west side and north side of the building. • We believe that our project will have a positive impact on the subject property and bring many jobs to the community. Building a Good sense of community is key to us as owners, operators and developers. We do not have a third party management company to maintain the highest level of care. Our goal is to build a good sense of community with Eagan residents that need and want high quality memory care in the community for their loved ones to thrive as they age in place. Many members of the Eagan community probably have experienced a loved one with dementia. This disease affects 1 in 3 seniors. In the twin cities, there is a large shortage of memory care beds. There is a major disconnect for seniors and housing. We would bring about 35 jobs to the city and many members of the community come volunteer on a weekly basis whether it is music therapy, arts and crafts, reading activities or baking with our residents. This is how a strong sense of community is built by bring different generations together to help each other. Our seniors deserve a place to rest easy and age in place. City recommendations taken into consideration: • Pushing the ingress as far west on Highview to reduce traffic congestion at Pilot Knob per the city’s and neighbor’s suggestion that can be seen on the site plan. • Maintaining a mature and heavy buffer with an undisturbed tree line along the west side between the existing neighborhood and site with large trees that currently exist. • Eliminating access off Pilot Knob to prevent traffic issues and for safety • Maintaining building setbacks per code • We are dedicated to maintaining a good relationship with the neighbors in mind and having a follow-up meeting in February with the neighbors to discuss any concerns that we can address. • Adding sidewalk from the east side of the building to connect with the existing sidewalk on Pilot Knob Rd. for access • Storm ponding will meet city code and be done on site • Parking will consist of 21 parking spots as no residents drive but family, physician services and employees will need to park. • Our use will be a low traffic generator and there have been less than 10 emergency vehicle calls to date at our other site in savage. Our residents are usually in bed by 8 pm and we will work with the neighbors to integrate into the community. Site deviations from Zoning performance guidance: • The size of the building has grown slightly larger than the original concept presented to the city; however, the unit count has gone down to 28 units. The reason the building has grown is due to site configuration and the building having a 45-degree angle to best fit on the site and move the parking to front. We are dedicated to keeping this building a nice buffer with a residential look and feel. • With a Planned Development we would be looking at a higher ground coverage ratio of closer to 31 percent to make our building fit on the site. The building would be about 23,858 square feet which would be a larger footprint. Therefore, we would be asking the city to allow a higher building ground cover ratio. • Because our residents have dementia we need to have a one level building for circular flow and to have the most efficient staffing ratios to cover residents. A two story building is too hard for individuals with dementia to use elevators and harder for staff to manage. Maintaining staffing ratios and have the programming our residents desire is critical to having a one level building. • Detached trash enclosure would be very close to the south side of the building. • Lesser pavement setback to south side just for the drive lane because the building is taking up a little more of the site. • What impact does the rezoning have on City services, such as sewer, water, storm water run- off and roads? • We believe that the infrastructure is currently sufficient along Pilot Knob Rd. including readily available sewer and water to handle the project from engineering assessments. The storm water management will also be handled on- site through means of storm ponding. • Does the requested land use proposed by the rezoning result in a better use of the land? • Per the comprehensive guide plan chapter 3 under land use our use meets much of the criteria listed out under policies of residential and we do believe the use of the land will be a better use after the rezoning. Related goals and policies appear in other chapters such as Housing and Economic Development. Here are the Goals that are listed out. 1. Continue to maintain a land use pattern that reflects a variety of land uses including residential neighborhoods of varying densities and housing types; retail commercial and office areas; and industrial and service employment areas. Our proposed project would fit the criteria of having a varying density. 2. We would emphasize high quality development that reinforces Eagan’s strong community identity and its reputation as a highly desirable place to live, work and play. 3. Our land use would help to maintain a strong tax base in the community of Eagan and we are for profit and generate a strong tax base for the community. 4. Encourage green technology and sustainable development. By using high quality materials, spray foam insulation, triple pane windows, having the capability of running on a generator, having limited plastic use and utilizing recycling we would help promote green technology. 5. Our use would respect the natural environment while encouraging infill development and redevelopment. We would also maintain the natural beauty of the lot and preserve as many trees as possible and prefer to keep 95% of the natural beauty. Per the comprehensive guide plan chapter 3 under land use our use meets much of the criteria listed out under policies of residential: #6. Encourage residential neighborhoods that support active living and aging in place. In closing we feel that our use fits many of the comprehensive plan guide criteria and the rezone to a planned development. Our use would be great for the community and act as a great buffer and transition to the neighbors while maintaining a strong residential feel with a single story building. The use would support the greater need of aging population in Eagan and the site is conveniently located close to shopping, support services and malls. Our use is a great buffer and will help bridge the gap between the shortage of senior housing and good medical care in the area for seniors. We will generate a strong tax base for the community, create about 35 full and part time jobs while maintaining a soft use with low traffic for the area. We would be honored to bring a strong sense of community to Eagan and promote community outreach with members who volunteer. Currently hospitals, transitional care units and families are struggling to find a home for their loved ones to age in place. We can help bridge that gap and would be honored to be part of the city of Eagan. Our use would be a perfect buffer/transition between the heavily treed single family home to the west, busy Pilot Knob Road to the east and a medical clinic to the north. Please consider these residents as they are underserved and need a place to call home. Thank you for your consideration and time. 1 Pam Dudziak From:Laberee, Erin <Erin.Laberee@CO.DAKOTA.MN.US> Sent:Monday, September 27, 2021 9:20 AM To:Pam Dudziak Cc:Chatfield, Kurt; Sebastian, Kristi Subject:2811 Pilot Knob Road Attachments:05_ROL_Concept Site Plan.pdf Hello Pam, Kurt Chatfield ask me to respond to the request for comments on the 2811 Pilot Knob Road site development. We would request the City consider restricting access on Pilot Knob Road and have all access come off of Highview Avenue. Due to the high volume of traffic and lack of turn lanes on Pilot Knob Road access management is important to improve safety and mobility. We’d be happy to discuss in more detail if needed. Thank you for the opportunity to comment. Erin Erin Laberee, P.E. Assistant County Engineer Transportation Department P 952-891-7122 W www.dakotacounty.us A 14955 Galaxie Avenue, Apple Valley, MN 55124 Note: This email and its attachments may contain information protected by state or federal law or that may not otherwise be disclosed. If you received this in error, please notify the sender immediately and delete this email and its attachments from all devices. 1 Pam Dudziak From:Sue Martin <mnmartins403@gmail.com> Sent:Sunday, September 26, 2021 12:20 PM To:Pam Dudziak; garyhansen@1stcounsel.com; APC Subject:Possible zoning change at 2811 Pilot Knob Road Categories:Yellow Category Dear Advisory Planning Commission members, Ms. Dudziak, and Mr. Hansen: I am writing in regard to the proposed zoning change in my neighborhood, from L/D Low‐Density Residential to O/S Office Services. We've lived here for four years, and have enjoyed seeing more and more families with children move in as the houses turn over. It's a delight to see children riding their bikes or walking with their parents to the playground at Highview Park. We have no sidewalks, but our streets are quiet and traffic speeds are safe. We're looking forward to our first grandchild later this year, and hope he will be able to safely enjoy our neighborhood, too. My husband and I enjoy access to bike trails close to our neighborhood, also. We ride our bikes directly from our home to either the trail along Pilot Knob or the Big Rivers Trail adjacent to Hwy 13. While there are no bike paths or lanes in the neighborhood, we feel safe riding on the street. I'm afraid all of that will change if the property at 2811 Pilot Knob, on the corner of Highview Avenue, is developed by Rivers of Life for an assisted living/memory care facility. Increased traffic from employees, visitors, delivery drivers, and emergency services would be highly disruptive to our low‐density, residential neighborhood. Please do not amend the 2040 Comprehensive Plan from L/D to O/S at 2811 Pilot Knob Road at Highview Avenue. Thank you for your consideration, Susan Martin 2899 Highridge Terrace Eagan, MN 55121 952‐221‐6878 1 Julie Strid From:Patricia Marrinan <patmarsol@gmail.com> Sent:Sunday, September 26, 2021 12:49 PM To:APC Subject:Opposed to rezoning at 2811 Pilot Knob To the Advisory Planning Committee: As a homeowner on Highview Avenue, I am opposed to the rezoning of the northwest corner at Highview and Pilot Knob. Redesignating this area from residential to commercial would have a huge impact on the surrounding area and the neighborhood as a whole. While not opposed to the proposed development in general, the location is not suitable and wrong on several fronts. Having a driveway for a commercial business that feeds onto a residential street will dramatically increase traffic where neighbors walk dogs, strollers, bike and exercise. There are no sidewalks so this is the space available to those of us that live here. While there are other businesses on Pilot Knob which is a main artery, there are no other businesses on Pilot Know that feed onto a residential street. Making a zoning change in order to also affect traffic patterns in a residential community negatively is wrong. The houses already exist and the new business does not. The placement of the driveway on Highview Avenue is very close to Pilot Knob. Vehicles turning right onto Highview Ave are creating a blind intersection Highview Ave has already become a link between Hwy 13 and Pilot Knob and increasing the traffic that speeds through the neighborhood places a risk on all who walk, drive, wait for school buses and bike on the street. The footprint of the building leaves little space for adequate parking on the property when you consider employees, delivery trucks and visitors of all kinds. Parking on Highview, Ave right around the corner from Pilot Knob places cars in the path of a walker and also a driver making a turn onto Highview. There would not be room for residents to enjoy the outdoors in a park‐like environment on the property. Delivery vehicles are often large and sometimes transport hazardous materials such as oxygen containers or other equipment that would increase wear and tear on the neighborhood street. There is no public transportation that would accommodate potential employees, residents and there is not a viable place nearby to provide such an option. Making a left hand turn from Highview Ave(30mph) onto Pilot Knob (45 mph) is already difficult at best and adding more vehicles will increase that difficulty. As a driver who has been rear‐ended while making a left hand turn from Pilot Knob (45 mph) onto Highview Ave where there are no left turn lanes makes the corner already dangerous and adding traffic is certain to exacerbate the problem. What guarantee is there that this would be a one story building and that the number of residents accommodated and thus the number of employees working there would not be increased? Thank you for your consideration of my concerns. Patricia Marrinan 1461 Highview Ave Eagan 55121 651.767.2514 1 Pam Dudziak From:Katie Mohar <katiemohar@gmail.com> Sent:Monday, September 27, 2021 12:20 PM To:Pam Dudziak Subject:Zoning change - opposition Dear Ms. Dudziak, I'm an Eagan resident writing regarding the requested zoning change for the property on the NW corner of Highview and Pilot Knob, from Low‐Density Residential to Office/Services ‐ for the purpose of building an assisted living/memory care facility. I oppose this requested zoning change. Thank you. Sincerely, Katie Mohar 2858 Sibley Hills Drive Eagan, MN 55121 1 Pam Dudziak From:Jane Longueville <jlongueville@comcast.net> Sent:Monday, September 27, 2021 2:18 PM To:Pam Dudziak Cc:APC Subject:RE: Re-zoning at 2811 Pilot Knob Road Importance:High Categories:Yellow Category I am writing to express concern about changing the zoning of the property on the corner of Pilot Knob and Highview from residential to office/services. This lot is embedded in a residential community that is not set up to handle more traffic and blockage when pulling out onto Pilot Knob. It is already difficult for us to exit our neighborhood onto Pilot Knob during any sort of traffic because of the speed that people are driving the sometimes impaired views as you try to pull out, especially at this corner. This re‐zoning seems like it would make this corner much busier and more dangerous without any sort of traffic control. Also, this is a very quiet and safe residential neighborhood, despite how close it is to several major highways and to Town Centre. As a long‐time resident, I would like it to stay that way. Thank you for your consideration. Jane Longueville 2895 Highridge Terrace 1 Pam Dudziak From:Andy Grams <andy.grams@gmail.com> Sent:Monday, September 27, 2021 3:36 PM To:Pam Dudziak Subject:Disapproval regarding project 04-CG-04-08-21 Hello Pam ‐ My family lives at 1474 Highview Avenue down the hill from the proposed re‐zoning and construction of the Rivers of Life facility. We first lived in an apartment off Yankee Doodle, then a number of years at a townhome just a block away. We moved to this location in 2014 with our three kids, drawn by the mix of families ‐ couples starting out, families with young kids, families with older kids, empty‐nesters. We learned that this was largely due to the neighborhood initially starting from farmland, slowly partitioned over the years by family, then friends of family, and then newcomers became part of that network. That depth showed a well‐established neighborhood full of relationships, something we wanted to invest in long‐term. We have been investing in our property and home, improving, now looking to expand the footprint of the home ‐ all with the intent of improving how we can better host the neighborhood. Up until the pandemic hit, we were hosting neighborhood movie nights in our back yard, and the shared green space there had become a big gathering ground for kids around the neighborhood, including from homes right near the proposed building site. We are hoping covid winds down a bit more so we can get back to normal neighborhood gatherings. If this project were to be given approval, I fear the long term appeal of the neighborhood will be damaged. Once the neighborhood is ruptured by this business intrusion, it will be easier for 'office sprawl' to creep further into the neighborhood down Highview, as adjacent homeowners to the facility will want to leave sooner and property values will go down, be sold for office land, and the infection repeats and continues. Another concern is the encouraged traffic increase up and down Highview. Especially on the slope, where we are at, it can be VERY tempting for cars to blast through the neighborhood if they are simply cutting through from or to Hwy 13. A long‐term care facility will bring the added problem of frequent emergency vehicles. Even if they arrived via Pilot Knob, we would all certainly hear them. This neighborhood is quiet, and we all like that. At night it is dark, only sparsely lit, and we like that. This business intrusion would change that up and down Highview. How soon would it be before we have to give up a portion of our properties for widening the street, adding more light fixtures and signs, to make it as busy as a county road thoroughfare like Lone Oak? The neighborhood is full of families that love to walk around the blocks, with kids, with pets, kids going to and from other kids' houses ‐ a prime way folks end up connecting and interacting while stopping by others outside. Added traffic, especially up and down Highview, would make that neighborhood‐building activity dangerous and less appealing. Currently, the only dangerous time is early Monday with all the garbage trucks ‐ we don't need that kind of hazard 24‐7. This kind of neighborhood that we are in and trying to continue to nurture, is a wonderful but fragile asset that the city of Eagan needs even more than the large scale business developments it wants to attract. If you want to develop a robust, connected community committed to invest in where we are at for the long term (= a more stable and growing tax base) then these types of neighborhoods must be strongly protected from encroaching businesses, who are not commited like we are committed. We have nothing against Rivers of Life as a company ‐ we are simply against them altering our neighborhood ‐ and it would not be for the better. There is plenty of space in Eagan already zoned for office ‐ currently occupied and unoccupied. In the last 18 years we have seen Eagan farmland and forests and woodlands turned into office space, retail space, apartments, more apartments, condos.... I'm trying to recall.... I'm not recalling any construction of single family 2 homes... maybe a handful south of Yankee Doodle/Coachman. So no need to cut down "old growth" neighborhoods like ours. I don't think Rivers' presence is geographically required in our neighborhood for them to successfully conduct their business. If they need scenery, Viking Lakes might be a better option, and still get the highway access. I handed out letters to some nearby neighbors after chatting with the neighbors up near Pilot Knob, and so far, no one wants this office development to happen or any re‐zoning attempts ‐ and these were people not even on Highview and either did not have kids or were empty‐nesters ‐ they were concerned for the whole neighborhood, as should be the City of Eagan. Thank you for reading. Andy Grams ‐‐ Andy Grams Design Solutions, LLC Graphic Design / Art Production www.andygrams.com 612.554.8041 1 Pam Dudziak From:Micah Olson <molson14@gmail.com> Sent:Monday, September 27, 2021 12:48 PM To:Pam Dudziak Subject:Signed Petition Attachments:Petition to Oppose 2811 Pilot Knob Project_Signed_09272021.pdf Hi Pam, We spoke last Friday on the 2811 Pilot Knob project, and you answered a whole bunch of my questions. The neighbors got together this weekend and decided a petition was an effective way to speak out against this project. There were a number of neighbors who haven't had a chance to sign that I hope also were able to write in to you. I plan on continuing to collect signatures in advance of the City Council meeting on Oct. 5th as well. Find the petition attached. There are about 40 people represented there. Please let me know you received this and if you have any other information to share in advance of the meeting tomorrow night. See you then. Micah Olson 1427 Highview Ave 952‐201‐9464 1 Pam Dudziak From:monicamcagle@yahoo.com Sent:Tuesday, September 28, 2021 11:29 AM To:adc@cityofeagan.com; Pam Dudziak; garyhansen@1stcounsel.com Subject:Proposed Zoning Change 2811 Pilot Knob Categories:Yellow Category Dear Advisory Planning Commission members, I live on 1470 Highview Ave and wanted to share some reasons why I believe it’s a bad idea to re-zone the corner of Highview Ave and Pilot Knob. We’ve been here for just over 5 years and have two kids. In that time, this community has become our home and a fantastic place to raise our kids. We meet friends almost daily on our walks with our dog and to the playground. We bike the trails along Pilot Knob to Pilot Knob Elementary School and to Eagan Community Center for Market Fest and other activities that this great city has to offer. Our kids are reaching the age where they walk the streets up the hill to meet up with their friends. There are constantly kids using these streets to walk, bike, and interact with each other. It’s not appropriate to direct traffic for this facility onto a narrow residential road like Highview Ave. In addition, turning traffic off Pilot Knob is also risky with this narrow road. I don’t think this facility is a good fit for the neighborhood. Please do not amend the 2040 comprehensive plan from L/D to O/S at 2811 Pilot Knob Road at Highview Ave. Thank you for your consideration, Monica Cagle 1470 Highview Ave 651-470-5757 1 Pam Dudziak From:Michelle Buvik <mbuvik@msn.com> Sent:Monday, September 27, 2021 8:38 PM To:City Council Cc:Pam Dudziak Subject:Comprehensive Guide Plan Amendment from LD to O/S, File Number 04-CG-04-08-21 As a neighbor of 2811 Pilot Knob Rd, I would like you to know that I am against changing our neighborhood from Low Density to Office Service. The access for the proposed facility to Highview will increase traffic and endanger our walking pedestrians that use the road. Thank you Michelle Buvik 1416 Highview Ave 1 Pam Dudziak From:jlpolski@aol.com Sent:Tuesday, September 28, 2021 9:41 AM To:APC Cc:Pam Dudziak Subject:River of Life Rezoning Request Attachments:Eagan Highview.pdf Categories:Yellow Category Attached is a letter respecting the issue on the agenda this evening. Thanks for reading. Joe Polski 1447 Highview Ave Eagan, MN 551221 Email: jlpolski@aol.com Phone: (H) 651-454-1675 (C) 612-720-7236 Joseph P. and Linda A. Polski 1447 Highview Ave. Eagan, MN 55121 Phone: H (651) 454-1675 C (612) 720-7236 E-mail: JLPolski@aol.com DATE: September 28, 2021 TO: Eagan Advisory Planning Commission SUBJECT: Rivers of Life Project, File Number: 04-CG-04-08-21 We are residents of Highview Ave, approximately one block west of Pilot Knob Road and respectfully request denial of the rezoning application noted in the above file. Below are some concerns: A. Traffic. It is unreasonable that the only access to this building is from Highview Ave. The site plan provided to the neighborhood is wrong as it also shows access from Pilot Knob. Apparently that will not be allowed. Have thoughts been given regarding access for food delivery trucks that are likely to be semi’s? How about trash trucks? Is there turnaround room for them? I believe there will be more traffic than the project documents state. There are 32 rooms. Each of those rooms will have visitors. With 32 residents, there will be staff plus administrators in and out at all hours. The driveway into the property is too close to Pilot Knob Road. Traffic congestion will undoubtedly occur at the intersection. B. Noise issues, No. 3. Contrary to the Planning Report, I would submit that the property IS located parallel to a primary runway used by jets, that being 29L. I can also attest that the runway is often used for takeoffs, not just landings. C. Environment. The site plan says existing trees on the property will be retained. Because sewer, water and perhaps gas will have to come from Highview, at least some of the trees will need to be cut down to provide access. The current screening cannot be retained in its current state. Hopefully the zoning change request will be denied. Thank you for taking the time to read this and thank you for your service to the City of Eagan. 1 Pam Dudziak From:roger sperling <roger_sperling@hotmail.com> Sent:Tuesday, September 28, 2021 1:10 PM To:Pam Dudziak Subject:Fwd: REFLECTIONS AND THOUGHTS Begin forwarded message: From: roger sperling <roger_sperling@hotmail.com> Subject: REFLECTIONS AND THOUGHTS Date: September 28, 2021 at 1:01:33 PM CDT To: roger sperling <roger_sperling@hotmail.com> To: Eagan Planning Committee, Eagan City Council, Metro Council Regarding: River of Life application Factual statements—— absolutely NO effort was made to contact me (the most affected of all property owners) by any staff member of the developer or any staff member of this city or city committee. I received no written correspondence regarding this development. The first and only information received was the notice of hearing (mailing date 9/14), and, which was not received until Monday the 20th. Background——— I am 88 yrs.old. I may be the oldest active survivor of the Paul Hauge, Luther Stalland, Art Rahn, Herb Polzin, Tom Diffley, John Kline township era. I served on the planning committee and worked with these people. My wife and I purchased our land around 1955, built and moved in around 1958. The daughter of the person from whom we purchased the land still lives amongst us with her family. When we started our life here, the original public notice for Eagan was the actual Lone Oak tree, Pilot Knob Rd. was a narrow 2 lane lousy road, and, Highview was an equally lousy muddy road where we might have to park our car on Pilot Knob in order to get to work the next morning. I was requested to be the Eagan rep. to the Metropolitan Airports Commission—and, was supported in my decision to resign under protest as a way of showing MAC our total objection to the repeated dumping of virtually all aircraft over Eagan. Don Knight, Don Chapdelaine, and I initiated the actions to seek conversion of township to first village and then city status through actions within the jurisdiction of the then relatively young Metropolitan Council. I had written articles titled “ The Death Knell of Rural Eagan” prior the conversion action. 2 Today————after decades of working to establish within this city a deep respect for the importance of “neighborhood”, and, after more decades of hard dedication by many other people who served AT NO REMUNERATION to codify that respect by ascribing high status to the classification “single family residential”—once again a self serving interest will try to penetrate that high status. I am extremely proud of my neighbors who are realizing the insidiousness of this developer action——they have touched on numerous excellent points—and, most importantly, they also recognize the worst single line on the public notice is the very fine print “ The above request may require other variances————“. No truer words have ever been uttered——even WAY back, we old timers had a saying “ the developer’s concerns for the community expressed today will greet us tomorrow as a list of variances “. My position ———I AM VISCERALLY AND INTELLECTUALLY AGAINST WHAT I BELIEVE IS AN ILL THOUGHT OUT PLAN FRAUGHT WITH POTENTIAL LEGAL ISSUES, VARIANCES, AND, HARMFUL PRECEDENTS FOR EAGAN. My concerns——— as usual, all visual depictions by the developer portray " show stopper grandiosity” . BUT, what about items like garbage pickup, setbacks, traffic ingress/egress and the road locations for those, as well as deliveries, visitations from relatives, health care professionals, social worker contacts, etc. Next, all the concerns my neighbors expressed ARE valid—in particular, egress from Highview is a “sticky wicket”——when the Covid issue is over, the insane traffic numbers for Pilot Knob will return to full count. Let me put it to you this way——I feel a real threat to my longevity every‐time I contemplate a left turn exiting Highview— there is no speed enforcement (quite honestly—it would be suicidal for police to attempt a stop and pullover ). During the rush hours, 50 mph is the norm. As far as the comment by neighbors of Highview being a cut‐thru——absolutely true. I am very suspicious of any care facility like this with 25 to 30 residents and a "couple of dozen” staff. This is pure non‐sense; and, the responsible parties know it . I have first hand knowledge AND CAN PROVE IT of a true number count from one of the Presbyterian Homes care facility——as of a month ago, the home had 60 care people and a support staff of 140 for those 60. Secondly, it is unfortunate, but we all live in a litigious culture; therefore, promulgating a situation for traffic death because of egress of vehicles or facility security breech of one of those people under care. My father‐in‐law was a care patient in a Wilder care center—he decided to go for a walk (age 92)—he was tough as nails—so, he walked from Robert St. in W.St.Paul to the downtown St. Paul police station to say Hi to some friends. The Wilder facility was also fenced. The first ANYONE knew was when I got a call from one of the officers saying he was with them visiting and would I like to come and get him—— they could not believe he had made it. 3 My parting thought to each of you is———When Wilder learned from the police and, shortly after, from me when I brought him back to Wilder ——would you guess in todays' culture Wilder would be a “bit” nervous (and, they were even back then). TO THE PLANNING COMMITTEE AND THE CITY COUNCIL—— EAGAN HAS MANY OTHER FAR SAFER AND LEGALLY INSULATED AND FRANKLY NICER PROPERTIES AVAILABLE——WITHOUT JEOPARDIZING THE INTEGRITY OF SINGLE FAMILY RESIDENTIAL. 1 Pam Dudziak From:Pam Dudziak Sent:Thursday, September 30, 2021 3:15 PM To:Pam Dudziak Subject:FW: 2811 Pilot Knob Road Proposed Rezoning From: brian burns <mnburnsbunch@yahoo.com> Sent: Thursday, September 30, 2021 1:32 PM To: City Council <CityCouncil@cityofeagan.com> Cc: Micah Olson <molson14@gmail.com>; brian burns <mnburnsbunch@yahoo.com> Subject: 2811 Pilot Knob Road Proposed Rezoning Dear Mayor McGuire and Council Members Bakken, Fields, Hansen and Supina. I hope this finds you all well. I and many fellow Highview Acres neighbors attended the Advisory Planning Commission meeting on 28 Sept to voice our concerns regarding the proposed rezoning of 2811 Pilot Knob road to pave the way for the building of a 32 bed memory care center. While we acknowledge the need for this type of facility in the community, we strongly object to a location that has been residential for decades, and immediately borders our residences. All of us that have purchased properties here were counting on the area remaining low‐density residential. The building of a large memory care center would change the character of our neighborhood forever, and likely lead to additional changes further encroaching on our neighborhood. There are also concerns about the increased traffic risks at the intersection of Pilot Knob and Highview Ave, especially given that the proposal states that 100% of the access will be via Highview Ave. A major concern is traffic entering Highview Ave from Pilot Knob. Cars entering the facility would need to make a nearly immediate right turn leaving little to no room for vehicles to queue. The Advisory Planning Commission voted 3 – 3 to neither recommend for or against the rezoning. I hope that their lack of a recommendation will carry weight with you at the council meeting of 5 October. While the property owner is entitled to sell the property, he enjoyed living in our neighborhood for many years as it is currently zoned, and we request that it remain zoned low density residential. I understand that he is now an official resident of FL, so his concern for the neighborhood is likely diminished. I am extending an invitation for you to come to our neighborhood to meet with us and view the area. Most anytime this weekend 2 or 3 October can work. I hope you will accept the invitation. Please contact me via my mobile phone 651‐ 303‐8397 to make arrangements. Sincerely, Brian P. Burns 1430 Highview Ave Eagan, MN Sent from Mail for Windows 1 From:Sue Martin <mnmartins403@gmail.com> Sent:Friday, October 1, 2021 3:25 PM To:City Council Subject:Request for zoning change at 2811 Pilot Knob Road Dear Members of the Eagan City Council: I am writing in regard to the proposed zoning change in my neighborhood, from L/D Low‐Density Residential to O/S Office Services. I believe the Comprehensive Plan got it right in designating 2811 Pilot Knob Road as Low‐Density Residential. Recent deliberations by the Advisory Planning Commission bear that out. 1.The APC learned from city staff that Dakota County is likely to prohibit continued access to Pilot Knob from that property in the future. Instead, access to the property would be from the residential street Highview Avenue, tying it more closely to the residential neighborhood rather than the commercial properties to the north. 2.A logical boundary exists between low‐density residential and office/services, running east‐west on the north property line of residences along Highview Avenue, continuing across Pilot Knob along Avalon Avenue. 3.A transitional business already exists in the form of Children's Therapy Center and Leafline Labs, adjacent to 2811 Pilot Knob Road. 4.Should the assisted living/memory care facility come to fruition, city staff predicted neighborhood traffic would increase 20%. The 2040 Comprehensive Plan was adopted very recently, March 2, 2020. It received key input from the APC, and a year‐ long community engagement process. I believe it is well‐informed and reviewed, and reached the right conclusion about 2811 Pilot Knob Road. Two points seem relevant to me: 1)As a policy, the plan serves to "preserve and enhance the vitality and character of existing neighborhoods" (Chapter 3, Land Use Policies, page 2). Changing 2811 Pilot Knob from L/D to O/S would change the character of our neighborhood. 2)"Demand for [low‐density] residential property is likely to remain strong for some time" (Chapter 3, Land Use Growth and Redevelopment, page 5). The L/D designation allows for up to 4 units per acre, and those options would fit with the character of the neighborhood. Thanks for your consideration, Susan Martin, 2899 Highridge Terrace, Eagan 1 From:Cindy Starr <cmorrissey1851@gmail.com> Sent:Saturday, October 2, 2021 4:02 PM To:Mike Maguire Cc:Paul Bakken; Cyndee Fields; Gary Hansen; Mike Supina Subject:River of Life proposal Follow Up Flag:Follow up Flag Status:Flagged I am writing to ask that you deny the amendment to the 2040 plan that would allow this commercial development at the corner of Pilot Knob and Highview Avenue. Highview Avenue is the gateway to a completely residential neighborhood. I realize there has been some recent commercial development on Pilot Knob but these developments do not spill into residential areas. The Holiday is set apart by itself and abuts the entrance to an office park. The newer office building backs up to the golf course. The River of Life building would be right next to a residential home and directly across the street from more residential homes. All the other lots on Pilot Knob, down to Lone Oak Road, are residential. If the developer was considering townhomes or some other type of almost low‐density residential then maybe it would be something to consider. With this proposal there would be a high level of traffic not just with staff but with outside health contractors, food suppliers, and other vendors. While this project can appear as "residential" it is most definitely a business. We chose this neighborhood for the privacy and peace it allows us while remaining very close to our jobs in St. Paul. We realize the airplane noise might bother some people but we overlooked that in exchange for the opportunity to live in a neighborhood that actually has quite a "rural' feel. Because we are so close to the river we see and hear tons of wildlife. One of the huge draws to the neighborhood is that there are no streetlights which actually promotes the abundance of wildlife. I was surprised to see that River of Life plans on using Highview Avenue as its only access point. Someone I spoke with compared Highview Avenue to Lone Oak Road. There is no comparison as Lone Oak is a county road and Highview avenue is a city street and strictly residential. There has been a lot of turnover in the neighborhood in the last few years. Young families are moving in. There is a park right up the road and the minimal traffic makes the neighborhood a great place for kids to bike, rollerblade and walk their dogs. The kids run from one yard to another all the time. It's a healthy place to raise a family. I don't understand why you would feel it necessary to take away the low‐density residential classification of this piece of land. There are many other available sites in Eagan. I do wonder if this is because the current owner has not been able to find a buyer and the current owner is the one pushing for the change. Please keep the land classification as it is and deny this request. The change to our neighborhood would be beneficial only to the developers/owners and to the seller of the land. It would have no benefit to any of the people who actually call this neighborhood home. 1 From:Shari <sk2004@comcast.net> Sent:Saturday, October 2, 2021 7:04 PM To:Mike Maguire Subject:Proposed Development at Pilot Knob and Highview Ave Follow Up Flag:Follow up Flag Status:Flagged Dear Mayor MaGuire, We are writing to express our strong opposition to the proposal by River of Life to put a commercial service building in our residential neighborhood. We moved to Highview Avenue 30 years ago. The neighborhood has always been a quiet street where children learn to ride bicycles and families take walks or stroll their infants. There are two nearby parks which support recreation and attract children to play. The street is quiet, and not a major artery for traffic between Pilot Knob and Highway 13, especially because of a steep and winding decline at the western end of Highview Ave. We are extremely concerned that placing a commercial facility on the corner of Pilot Knob will significantly increase traffic, including the necessary delivery trucks to keep the large facility supplied. This will be detrimental to the ability to enjoy our neighborhood, as well as dangerous for children. Placing a traffic control light at the corner of Pilot Knob and Highview will in all likelihood increase the amount of through traffic (between Pilot Knob and Highway 13) because drivers, including commercial trucks, will likely conclude that Highview is a suitable through street. Furthermore, the increase in noise from delivery trucks, ambulances, etc that would be attendant upon the proposed facility will be detrimental to the quality of life for residents. Quite frankly, it is impossible to think that this proposed facility will not lower property values, and accordingly the tax base which supports the city and our schools. This proposal is NOT good for the neighborhood or the city of Eagan. Given the amount of commercial property currently vacant in Eagan, we are mystified as to why River of Life did not look at existing commercial property and are instead asking to have a residential neighborhood impacted by their proposal. Indeed, there is property approximately half a mile north of the proposed site that could undoubtedly support their facility, as well as other property scattered around Eagan. We are not against this facility coming to Eagan—but it should not be located in a residential neighborhood where it, or any other commercial/office/service property does not belong. For these reasons, we strongly urge you to deny the request of River of Life to amend the Comprehensive Guide Plan for our residential neighborhood and build a commercial property at the corner of Pilot Knob and Highview Ave. Thank you for your consideration, Bob and Shari Loushin 1451 Highview Ave 651‐353‐9124 Sent from Mail for Windows 1 From:Allan <musiceducator@gmail.com> Sent:Sunday, October 3, 2021 1:24 PM To:City Council Subject:zoning amendment for Highview Avenue & Pilot Knob Road Eagan City Council, As a resident of the neighborhood, I would like to communicate to the city council that I am in favor of the proposed zoning amendment in order to allow a memory care facility at the corner of Highview Avenue and Pilot Knob Road. My wife and I both have elderly grandparents that may need the use of such care facilities in the future, so I understand their need in the community. Further, I feel having such a care facility would ADD to the neighborhood rather than detract from it. I think it's wrong to reject something just because it's new and different, and I do not believe that the proposed facility would be harmful for our neighborhood or community. I also feel that having more jobs available locally would be a good thing. Please take these points into consideration when determining your vote on the issue on October 5. Thank you! Allan Huls 1567 Stephanie Circle Eagan, MN 55121 1 From:Clarice Hendrickson <roclar1341@comcast.net> Sent:Monday, October 4, 2021 6:52 AM To:Mike Maguire Subject:HIGHVIEW/SKYLINE/PILOT KNOB/NEIGHBORHOOD Follow Up Flag:Follow up Flag Status:Flagged I ASK YOU TO VOTE TO DENY THIS 2040 COMPREHENSIVE GUIDE AMENDMENT‐ ‐WE ARE AGAINST RUINING THIS NEIGHBORHOOD CLARICE HENDRICKSON 2870 HIGHRIDGE TERRACE. EAGAN 1 From:Elizabeth Brooks <elizabethe.brooks@outlook.com> Sent:Monday, October 4, 2021 8:30 AM To:City Council Subject:2811 Pilot Knob Rd Rezoning Dear Eagan City Council, I am writing to express my concerns with the proposed rezoning of the property on 2811 Pilot Knob Road. I am a new homeowner at 1467 Highview Ave and am nervous for the future of this neighborhood if this rezoning passes. This rezoning of a residential lot to allow for a commercial memory care building is dangerous to the character of our neighborhood as it crosses the already established “line” between commercial and neighborhood lots. If you look at the street Avalon Ave, everything south of this road is residential, while north of Avalon Ave is commercial. By voting to allow this rezoning, commercial businesses are now encroaching into the neighborhood boundaries. This could set a precedent that allows for more rezoning of residential lots in the future. This opens the door for future development into our neighborhood along Pilot Knob Road. During my fiancé’s and my search for our first house, we looked for over 8 months to find our forever home. We waited patiently for a house to pop up in this specific neighborhood as my fiancé grew up across pilot knob, and we knew we loved this area and want to buy in this community. We are so happy to be residents of Eagan, and hope to preserve this area as the beautiful residential neighborhood that drew us to it in the first place. Please vote to deny the rezoning of 2811 Pilot Knob Road on Pilot Knob and help us maintain this block as the family friendly, safe neighborhood it is. Thank you, Liz Brooks 1 From:linda rolland <lmzrolland@hotmail.com> Sent:Monday, October 4, 2021 10:02 AM To:City Council; Mike Maguire; Paul Bakken; Cyndee Fields; Gary Hansen; Mike Supina Subject:2040 Comprehensive guide plan for Low Density Residential to O/S Office Service I am a resident of the neighborhood being affected by this proposal. The traffic it would bring to Highview Avenue will not be good for the neighborhood. We have many families that use this area to walk their dogs and children daily. Adding more traffic to that area would make it unsafe for them to do that. This is a residential area, not something that a 32 bed memory care unit belongs in. Have them buy the property on Pilot Knob Road next to the Holiday Station or use one of the many buildings sitting empty in Eagan. Please do not ruin our neighborhood. Linda Rolland PH: (651-452-6659) FX: 651-452-7024 CEL: (651) 214-9360 1 From:Micah Olson <molson14@gmail.com> Sent:Monday, October 4, 2021 12:23 PM To:Mike Maguire; Paul Bakken; Cyndee Fields; Gary Hansen; Mike Supina Subject:2811 Pilot Knob Petition from Neighbors Attachments:Neighborhood Petition_ Signed_ 10042021.pdf Dear Mayor Maguire and Members of the City Council, I am writing on behalf of the neighbors of the proposed 2040 Guide Plan Amendment at 2811 Pilot Knob Road. The residents of the neighborhood are unequivocally against this proposed development. I hope you have had time to review the public comments on this issue surrounding neighbors' concerns with pedestrian safety and preservation of the character of our neighborhood. Attached you will find a signed petition with over 70 signatures from the neighborhood opposing this project. We appreciate your consideration of this issue and hope you share our concerns about this project's negative impacts on our neighborhood. Sincerely, Micah Olson 1427 Highview Ave 952‐201‐9464 1 From:William Pederson <billpederson@icloud.com> Sent:Monday, October 4, 2021 8:35 PM To:Mike Maguire Subject:Thanks for voting NO on October 5 Dear Mayor Maguire, I am writing to express my deep concern, and that of my family and neighbors, regarding the proposed amendment to Eagans 2040 Comprehensive Guide Plan that would allow for the commercial development of the corner of Highview Avenue and Pilot Knob. I / we DO NOT support this development and the proposed change. There still exists plenty of “backfill” property within Eagan, or Mendota Heights, that would readily accommodate the needs of this proposed care facility. The encroachment, in this neighborhood, is not necessary and I / we urge you to vote against this proposed change and development. The city of Eagan has done so many things right in its development over the past 27+ years we have lived here, it would be a real shame and an insult to those of us who live nearby to have this proposal go through. As you and your colleagues may recall, I was the individual who collaborated with our former fire chief, Mike Scott, to assist in the process of Eagan having a full time 24/7 staffed fire department. Just as Eagan rose to that occasion and now has a model fire department staffed, I urge the city council will rise to this occasion and vote down this proposed development. Increased congestion in a quiet neighborhood affects everyone in the area from street safety and noise to property values and quality of life. Thank you. Sincerely, Bill Pederson, Jackie Granus 1603 Skyline Path Eagan, MN 55121 billpederson@icloud.com Dear Eagan City Council members, September 30th 2021 I am writing to ask for your vote to deny the 2040 Comprehensive Guide Plan Amendment that is scheduled to be brought before the Eagan City Council on Oct 5, 2021. Though there are several reasons that I am opposed to this amendment, my letter will focus on two key impacts of the proposal of highest importance to me and my family: 1) reduced walkability of Highview Avenue limiting the opportunity for neighborhood physical activity and neighborhood cohesion and 2) the decreased safety of school-aged students while walking/biking to school or to the neighborhood bus stop. My name is Kelsey Besse, I hold a graduate degree from the University of Minnesota’s School of Public Health with a concentration in Community Health Promotion. I also have been a homeowner in the Highview neighborhood since 2013. I live with my husband and two young children on the corner of Bridgeview Terrace and Highview Avenue. It is from these two lenses, a public health professional and a parent of two soon-to-be school-aged children, that I present you with additional information supporting our family’s two highest concerns as described above. The Highview Avenue traffic study conducted in 2018, is inadequate to characterizes the anticipated impact to Highview Avenue. There are three concerns I would like to raise with regard to this study. First, I believe the use of the 2018 figures as a baseline for current Highview Avenue traffic is an underestimate. This study was conducted shortly after the initial development of the now highly-visited Eagan Commons (approx. 2 miles to the South). Myself and neighbors have frequently commented on the increase in traffic volume especially in the last 3-4 years. The current draw of the Eagan Commons resulting in traffic flowing through Highview Avenue would not have been fully captured at the time of this study. Second, the use of average traffic volume does not appropriately describe (masks) the key concern of traffic volume during peak periods (e.g. weekdays: AM & PM commute; weekends: daylight hours). These intense periods of traffic are also the times that walking, jogging, and biking most frequently occurs. Third, and most important, the impact to current traffic volume on Highview, cannot be summed up by a number. While the estimated increase of 10%, may seem relatively low from a numbers perspective, from a human perspective, each added vehicle represents a reduction in the perceived and actual safety of Highview Avenue for pedestrians and bikers. Both the perceived and actual safety of Highview Avenue equally matter. Neighbor’s perception of how safe Highview Avenue is, rather than the results of a traffic study, will guide decision-making for individuals and families when considering walking or riding along Highview Avenue. It is important that Highview neighbors continue to walk, bike, and jog along Highview Avenue. Physical-activity- friendly neighborhoods (also referred to as neighborhood walkability) help promote individual and community physical health, mental health, and overall wellness. Both the Centers for Disease Control and Prevention (CDC) and the Minnesota Department of Health (MDH), recognize the important link between the health of communities and their walkability. Further, the CDC highlights the influence local governments’ design decisions have on the impact to neighborhood walkability to include zoning decisions. By denying the 2040 Comprehensive Guide Plan Amendment, the city council would be aligned with the position of other levels of local government in supporting Safe Routes to Schools (STRS). Regular physical activity is especially important to the healthy development of children and for the prevention of childhood obesity. During the school year, biking or walking to school or the neighborhood bus stop, provides an important opportunity for school-aged children to engage in physical activity two times a day. Dakota County, District 197, District 196, and the neighborhood K-4 school (Pilot Knob STEM; less than 1 mile to the South) have all participated in comprehensive planning efforts to support the statewide Department of Transportation (DOT) Safe Routes to Schools (SRTS) initiative. Our Highview Avenue neighborhood is a neighborhood. For the last 8 years, I have run or walked countless times along Highview Avenue with family, friends, neighbors, the family dog, or alone. In addition to the health benefits, it has provided an invaluable impromptu opportunity to get to know our neighbors. Some examples include jumping in to provide a helping hand, an offering of condolences following the passing of a pet, welcoming new neighbors to the community, sharing news of a growing family, swapping parenting tips and sharing gripes, noticing a package left on a doorstep while the owner is away, checking in with elderly neighbors during the COVID-19 pandemic, helping capture a runaway dog, inquiring about a neighbor’s recovery following surgery, engaging in friendly banter over favorite sports teams, providing encouragement to an essential worker, the admiring of holiday displays, and finally, relaying the most recent coyote, songbird, deer, raccoon, or turkey neighborhood sightings. I hope that this letter provides important evidence to inform your upcoming vote and you will support keeping our Highview neighborhood a neighborhood by denying the proposal to change the zoning of the identified property from residential to business. Please let me know if I can answer any questions you may have about this information I have provided. Thank you for your consideration and thank you for your service. Respectfully, Kelsey Besse Kelsey Besse 2841 Bridgeview Terrace Eagan, MN 55121 1 Pam Dudziak From:Dianne Miller Sent:Tuesday, October 5, 2021 12:59 PM To:Pam Dudziak; Mike Schultz; Jill Hutmacher; Russ Matthys; John Gorder; Aaron Nelson Subject:FW: Please vote no to 2040 Comprehensive Guide Plan Amendment FYI—here is another letter that came in today, which will be printed and placed at the dais. Dianne Miller Assistant City Administrator 3830 Pilot Knob Rd | Eagan, MN 55122 Office: 651-675-5014 https://www.cityofeagan.com From: Kindra Szymanski <kmsszymanski@gmail.com> Sent: Tuesday, October 5, 2021 11:14 AM To: City Council <CityCouncil@cityofeagan.com> Cc: Mike Maguire <MMaguire@cityofeagan.com>; Paul Bakken <PBakken@cityofeagan.com>; Cyndee Fields <CFields@cityofeagan.com>; Gary Hansen <GHansen@cityofeagan.com>; Mike Supina <msupina@cityofeagan.com> Subject: Please vote no to 2040 Comprehensive Guide Plan Amendment Dear Eagan City Council and Mayor Mike Maguire, I live in the Highview/Skyline/Pilot Knob Neighborhood. I write to respectfully request that you deny the 2040 Comprehensive Guide Plan Amendment and do not approve River of Life building a memory care facility at 2811 Pilot Knob Road. My spouse and I moved into this neighborhood in 2017. We moved into our home, not because it was perfect, but because we loved the neighborhood and its location and believed, and found, it to be a wonderful neighborhood to raise a family. It is a quiet neighborhood, where people watch out for each other, the children, and family pets of the neighborhood. Neighbors are very careful when driving in this neighborhood and actually watch for children, pets, and animals. I am not sure if any of you live in this neighborhood, but I would guess that wherever you reside, if you were personally faced with the possibility that a 32 bed memory facility was going to be placed right in your neighborhood, that you would not be ecstatic. There are PLENTY of places in Eagan for a commercial building that are not within a neighborhood filled with families and that would not require approving an amendment to allow commercial use. Our particular neighborhood is unique as it is older and established ‐ there are houses from the 1950s with many residents that have lived here decades. And based on the communications regarding this issue within our neighborhood, it is a neighborhood full of people that care about this vote and do not want it approved. This is an opportunity for you to support your residents who this will truly affect. This is a neighborhood of residents that choose to reside in Eagan because of its community support, idyllic and safe neighborhoods for families, and the community's preservation of the older homes and character of the real estate. Approving this amendment sincerely jeopardizes this ‐ the safety of families ‐ their children and pets ‐ with increased traffic and opening the door for future commercial use in our neighborhood. 2 I thank you for your time and would greatly appreciate it if the Eagan City Council votes to deny the 2040 Comprehensive Guide Plan Amendment. Kindra Szymanski Resident of 2850 Highridge Terrace Eagan, MN 55121 1 Pam Dudziak From:Michelle Buvik <mbuvik@msn.com> Sent:Tuesday, November 16, 2021 9:00 AM To:City Council Cc:Pam Dudziak Subject:Public Hearing on 2811 Pilot Knob Rd. Lot 1, Block 1, Highview Access/File Number 04-CG-04-08-21 I would like to let you know that as a neighbor of 2811 Pilot Knob Road, I do not want our neighborhood changed from, Low Density to Office Service. I believe the resulting action of a access to Highview will cause more traffic, endangering the walkers and disrupt our quality of life. Thank you Michelle Buvik 1416 Highview Ave Eagan, MN 55121 Sent from Mail for Windows November 30, 2021 Pam Dudziak, Planner City of Eagan 3830 Pilot Knob Road Eagan, MN 55122 RE: City of Eagan – Rivers of Life Memory Care Residence Comprehensive Plan Amendment – Administrative Review Metropolitan Council Review File No. 22062-13 Metropolitan Council District 15 Dear Pam Dudziak: We received the City’s Rivers of Life Memory Care Residence comprehensive plan amendment on November 5, 2021. The amendment reguides approximately 1.93 acres from Low Density to Office/Service. The proposal is located at 2811 Pilot Knob Road. The purpose of the amendment is to accommodate redevelopment of the site with a 32-unit memory care residence. Council staff finds the amendment meets the Comprehensive Plan Amendment Administrative Review Guidelines revised by the Council on July 28, 2010. The proposed amendment does not affect official forecasts or the City’s ability to accommodate its share of the region’s affordable housing need. Therefore, the Council will waive further review and action; and the City may place this amendment into effect. The amendment, explanatory materials, and the information submission form will be appended to the City's Plan in the Council's files. If you have any questions regarding the review please contact Jerome Benner II, Principal Reviewer, at 651-602-1494 or via email at jerome.benner@metc.state.mn.us. As always, you can also contact your Sector Representative, Patrick Boylan, at 651-602-1438 or via email at patrick.boylan@metc.state.mn.us. Sincerely, Angela R. Torres, AICP, Manager Local Planning Assistance CC: Tod Sherman, Development Reviews Coordinator, MnDOT Metro Division Phillip Sterner, Metropolitan Council District 15 Patrick Boylan, Sector Representative Jerome Benner II, Principal Reviewer Reviews Coordinator N:\CommDev\LPA\Communities\Eagan\Letters\Eagan 2021 Rivers of Life Memory Care Residence CPA Admin Review 22062-13.docx Agenda Information Memo April 5, 2022, Eagan City Council Meeting VII. NEW BUSINESS A. Conditional Use Permit – Stanley & Wencl Action To Be Considered: To approve (or direct preparation of Findings of Fact for denial of) a Conditional Use Permit to allow outdoor storage of one cargo container, 16 trucks, and one 20-yard dumpster, upon property located at 3285 Terminal Drive, legally described as Lot 3, Block 1, Tan Me Addition, subject to the conditions listed in the Advisory Planning Commission (APC) minutes. To approve (or direct preparation of Findings of Fact for denial of) a Variance to deviate from the building materials standards for expansion of an existing non-conforming building, upon property located at 3285 Terminal Drive, legally described as Lot 3, Block 1, Tan Me Addition, subject to the conditions listed in the APC minutes. Required Vote For Approval: Majority of Councilmembers present Facts: The subject property is zoned I-1 (Limited Industrial) which allows outdoor storage via a Conditional Use Permit (CUP). The site contains a 12,004 square foot office/warehouse building, constructed in 2001 with access from Sun Drive. A CUP for outdoor storage of trailers was approved in 2009 for the subject property. The Applicant is proposing to expand the building nearly doubling its size, displacing existing outdoor storage and increasing required parking. The front parking lot will be expanded to 23 stalls and a driveway to Terminal Drive added. An additional 44 parking stalls will be constructed behind the building for a total of 67 stalls. The proposed new CUP requests outdoor storage of one storage container, 16 trucks and one 20-yard dumpster on the property. Eight of the trucks will be stored against the building at loading docks, and eight along the west edge of the lot. The dumpster was previously allowed via the 2009 CUP and is located in a fenced enclosure at the southwest corner of the lot. All but one of the performance standards for outdoor storage are met. The proposed outdoor storage occupies 9 of the 67 required parking stalls. These stalls are designated as proof of parking. The Applicant indicates an actual parking need of 52 stalls, and with 9 occupied by storage, 6 stalls are available for visitors. Also, the applicant states that trucks are stored on the site overnight and leave during the day, so eight of the stalls would be available for parking during the day. The Variance is requested to allow the building addition to match the exterior finish of the existing building, which predates the current exterior materials ordinance and is non-conforming. The existing building finish is a textured pre-cast concrete panel, and the proposed addition would match, providing a cohesive appearance. A public hearing was held on March 22, 2022, and the APC did recommend approval of both the CUP and the Variance. Issues: None 60-Day Agency Action Deadline: April 17, 2022 Attachments: (4) NBA-1 Location Map NBA-2 Draft March 22, 2022, APC Meeting Minutes NBA-3 Planning Report NBA-4 Report Exhibits YANKEEDRIVEF A R N U M DONALD AVEB O A R D W A L KSTATE TRUNK HWY. NO. 13BLA CK HA W K R O A D DONALD CO U RTASHBURY ROAD MEADOW VIEW ROAD DONALD AVELETENDRE ST BIRCHPONDRDALEXAND ERRD DRIVE LETENDRE ST ST.CHARLESPLACEALDENPONDLANECOACHMANROADTERMINALDRIVEHUNT DRIVE COACHMANROADCOAC H MANROADC O M A N C H E R O A D BOARDWALKCOUNTY ROAD NO. 28 (YANKEE DOODLE ROAD) FOUR OAKS RD M C C A R T H Y R O A D COAC H MANROADHERITAGELANECOACHMANROADBLUE CROSS RD.YANKEE D O O D LE R O A D BLUECROSSROADSKYLINECENTURY POINT MCCART H Y R D STATETRUNKHIGHWAYNO.13BALTICAVESTATEHIGHWAYNO.13KENNEBEC DRIVESky Hill Park QuarryPark Fort SnellingState Park Location Map 0 1,000500 Feet ´ §¨¦35E §¨¦494 Cliff Rd Diffley Rd Yankee Doodle Rd Lone Oak Rd Map Area Extent Project Name: Stanley & WenclRequest: Conditional Use Permit VarianceFile Nos.: 08-CU-01-02-2208-VA-01-02-22 Subject Site MINUTES OF A REGULAR MEETING OF THE EAGAN ADVISORY PLANNING COMMISSION EAGAN, MINNESOTA March 22, 2022 A regular meeting of the Eagan Advisory Planning Commission was held on Tuesday, March 22, 2022 at 6:30 p.m., at the Eagan Municipal Center. Present were members Vice Chair Jensen, Francis, Whitfield, and Cherner. Also present were, City Planner Mike Schultz, Planner Pam Dudziak, Assistant City Engineer Aaron Nelson, and City Attorney Bob Bauer. Absent was member Carol Whisnant, Steve Schwanke, Dan Sagstetter. AGENDA Member Francis moved, Member Cherner seconded a motion to adopt the Agenda. All voted in favor. Motion carried 4-0. February 22, 2022 ADVISORY PLANNING COMMISSION MEETING MINUTES Member Francis moved, Member Whitfield seconded a motion to approve the February 22, 2022 Advisory Planning Commission Meeting minutes. All voted in favor. Motion carried 4-0. III. VISITORS TO BE HEARD (10 MINUTE TOTAL TIME LIMIT) There were no visitors who wished to be heard. IV. PUBLIC HEARING New Business A. Stanley & Wencl, LLC Applicant Name: Dan Stanley Location: 3285 Terminal Dr; Lot 3, Block 1, Tan Me Industrial Park Application: Conditional Use Permit A Conditional Use Permit to allow outdoor storage of one cargo container and 17 trucks, 8 of which are to be located at loading docks. File Number: 08-CU-01-02-22 Application: Variance A Variance to deviate from the building material standards for expansion of an existing non- conforming building. File Number: 08-VA-01-02-22 Advisory Planning Commission March 22, 2022 Page 2 of 9 Planner Pam Dudziak introduced this item and highlighted the information presented in the City Staff report dated March 16, 2022. Chair Jensen opened the public hearing. There being no further public comment, Chair Sagstetter closed the public hearing and turned the discussion back to the Commission. There being no further public comment, Chair Vanderpoel closed the public hearing and turned the discussion back to the Commission. Member Whitfield moved, Member Cherner seconded a motion to recommend approval a Conditional Use Permit to allow outdoor storage of one cargo container and 16 trucks, and including one 20-yard dumpster, upon property located at 3285 Terminal Drive, legally described as Lot 3, Block 1, Tan Me Addition, subject to the following conditions: 1. This Conditional Use Permit shall be recorded at Dakota County within 60 days of approval by the City Council. 2. This Conditional Use Permit allows the outdoor storage of 16 trucks, one cargo container, and one 20-yard dumpster on the property. Outdoor storage is limited only to those items in the locations and quantities indicated on the approved Site Plan received March 8, 2022. 3. If the City determines that all required parking is necessary, the proof of parking plan shall be implemented and the owner will be compelled to remove the outdoor storage from the property to provide the required proof of parking. 4. All outdoor storage items, and the cargo container in particular, shall be maintained in a well kept manner. The 20-yard dumpster shall be maintained consistent with City Code standards for trash receptacles, with a cover and drain plug in place. 5. All new and existing mechanical equipment shall be shown on the Building Elevations plan, and the applicant shall demonstrate compliance with the screening requirements at the time of Building Permit application. 6. A revised landscape plan shall be provided with the building permit to eliminate the conflict between trees and utilities along Sun Drive. Shrubs and perennial plantings are acceptable alternative in this area. 7. An automatic irrigation system shall be provided for all landscaped areas. All landscaped areas shall be maintained in accordance with the landscape ordinance. Advisory Planning Commission March 22, 2022 Page 3 of 9 8. The applicant shall submit a revised Landscape Plan and Tree Mitigation Plan that fulfills the mitigation requirement indicated above through a combination of on -site mitigation planting and/or cash dedication. 9. A photometric site lighting plan shall be provided with the Building Permit application. The plan shall strive to achieve a minimum of 0.5 footcandles of illumination throughout the parking and outdoor storage areas, with not more than 1.0 footcandle at the property lines. All fixtures shall be downcast and shielded such that the source of light is not visible from off the property. 10. The applicant shall revise the storm sewer plan to add additional storm sewer and catch basin(s) to capture the drainage before it leaves the site, in a manner acceptable to the City Engineer. 11. This development shall provide hydrant spacing and locations in accordance with City Fire Department and Public Works standards. 12. All erosion/ sediment control plans submitted for development and grading permits shall be prepared by a designer who has received current Minnesota Department of Transportation (MNDOT) training, or approved equal training as determined by the City Engineer in designing stormwater pollution prevention plans. Also, all personnel responsible for the installation of erosion/ sediment control devices, and the establishment of vegetation for the development, shall have received Erosion/Sediment Control Inspe ctor/Installer certification through the University of Minnesota, or approved equal training as determined by the City Engineer. 13. This development shall comply with Eagan’s Land Disturbance Stormwater Pollution Prevention and Post-Construction Stormwater Management Requirements (City Code Section 4.34) for stormwater management and surface water quality, including Runoff Rate Control and 1.1-inch Volume Control of effective retention of the site’s new impervious surface area (including effective soil remediation for all of the site’s disturbed soils that are to be revegetated). 14. Prior to receiving City approval to permit land disturbing activity, the applicant shall provide appropriate soil analysis to the City to evaluate and ensure suitability for infiltration of stormwater, including, but not limited to, P200 analysis of SM soils encountered below the excavation extent. If the sub-soil analysis indicates incompatibility of existing sub-soil permeability, or shallow groundwater conflict, or soil contamination, with the submitted and reviewed design plans for meeting volume control requirements, the applicant shall revise the design and/or construction plans to ensure water quality equivalent of volume control requirements are fully met for the mitigated impervious drainage area, to the Advisory Planning Commission March 22, 2022 Page 4 of 9 satisfaction of the City Engineer. 15. The applicant shall provide adequately sized pre-treatment structure (e.g. four-foot minimum depth sump, five-foot minimum diameter, with floatable skimmer hood, energy dissipation, etc.) at, or immediately upstream of, any underground stormwater infiltration facility inlet to provide for effective capture and easily-accessible cleanout of fine-sand sized particles and floatable pollutants. Pre-treatment structures shall be accessible by appropriate maintenance equipment. Details shall be included in applicable plan sheet(s) using Eagan Standard Detail Plate E231. 16. Prior to receiving City approval to permit land disturbing activity, the applicant shall provide and include in the plan set all underground stormwater infiltration system details, including that a) an off-line bypass to prevent construction stormwater from entering the infiltration chambers shall be provided until drainage area stabilization has occured, b) solid bott om isolator row (appropriately sized) is provided at any stormwater inlet point into the underground systems, c) no limestone shall be used below or between the infiltration chambers, d) unobstructed physical access via manhole will be provided to either end of the isolator row for inspection and maintenance, e) 10-inch minimum diameter inspection ports will be provided on all infiltration chamber rows, and f) underground pipe gallery system shall be sized to fully provide instantaneous retention volume within the pipe gallery (not including the surrounding rock). Notes shall be provided that grading and utility contractor(s) shall provide 24-hours advance notice to City Water Resources staff of any grading or utility work involving the proposed infiltration pipe gallery system, including over-excavation, installation of pre-treatment structures, inlets, outlets, sump skimmer hoods, etc. Shop drawings related to the underground stormwater infiltration pipe gallery system must be provided to the City for review before installation. 17. During infiltration system over-excavation/sub-soil work, the applicant shall ensure that a Certified Soil Scientist will be present to verify and document that practice area sub -soils are suitable for a saturated-state infiltration rate of no less than 0.9-inches per hour (based on 0.45-inch per hour design rate with safety factor) or greater (but less than 8.0-inch per hour). If the sub-soil infiltration rates are less than 0.9-inches per hour (or greater than 8.0- inch per hour), the applicant shall immediately notify the City Engineer and revise the volume control practice(s) design and construction as necessary (e.g. over-excavation/soil- amendment depth, etc.) to ensure volume control requirements are fully met. Verification of sub-soil infiltration testing rates shall be provided immediately to the City of Eagan on the day of infiltration testing. The applicant shall ensure that the City Water Resources staff is provided 24-hour advance notice of the occurrence of infiltration verifications and also provided notice prior to any excavation and/or soil backfilling within the infiltration practices, to arrange for inspections. Advisory Planning Commission March 22, 2022 Page 5 of 9 18. Prior to receiving city approval to permit land disturbing activity, the property owner shall provide detailed Soil Management Strategies in the plan set for City review, and acceptance by the City Engineer, that provide graphical details and notes on soil protection/restoration in the Stormwater Management Plan and prominently included in all applicable plan sheets (e.g. Erosion & Sediment Control Plan, Grading Plan, Landscape Plan, etc.) and shall specify estimated quantities of soil ripping area and volume of compost to be imported and incorporated on pertinent plan sheet quantity tables. Prior to receiving a Certificate of Occupancy for any affected construction, Soil Management Strategy implementation documentation (e.g. haul tickets, representative on-site soil samples, compaction testing and soil organic content test results) shall be provided to City Water Resources staff to verify approved soil management strategy compliance. Notes shall be provided that implementing contractor shall provide 24-hours advance notice to City Water Resources staff prior to implementation of soil loosening and amendment. 19. Prior to proceeding with land disturbing activity, the Property Owner shall enter into a long- term stormwater management system maintenance agreement with the City, detailing the annual inspection and maintenance required to occur to ensure proper operation and performance of the private permanent stormwater management system, in a form acceptable to the City Attorney. 20. Before the city returns any Stormwater-related Performance Guarantee Fees on the development site, the applicant shall demonstrate that all stormwater mana gement practices are performing as intended and shall provide the City Engineer as-built plans meeting City requirements for as-built standard submittals that demonstrate that all constructed stormwater conveyance structures, stormwater management facilities (sump, underground infiltration pipe gallery, etc.), including soil loosening & amendment prior to landscaping, conform to design and/or construction plans, as approved by the City. Photos/video of final inspection of clean underground infiltration pipe gallery systems and contributing storm sewer shall be provided to the City Engineer. The applicant shall submit to the City Engineer certification that the stormwater management facilities have been installed in accord with the plans and specifications approved. This certification shall be provided by a Professional Engineer licensed in the State of Minnesota All voted in favor. Motion carried 4-0. Member Whitfield moved, Member Cherner seconded a motion to recommend approval a Variance to deviate from the building materials standards for expansion of an existing non- conforming building, upon property located at 3285 Terminal Drive, legally described as Lot 3, Block 1, Tan Me Addition, subject to the following conditions: Advisory Planning Commission March 22, 2022 Page 6 of 9 1. If within one year after approval, the variance shall not have been completed or utilized, it shall become null and void unless a petition for extension has been granted by the council. Such extension shall be requested in writing at least 30 days before expiration and shall state facts showing a good faith attempt to complete or utilize the use permitted in the variance. 2. All new and existing mechanical equipment shall be shown on the Building Elevations plan, and the applicant shall demonstrate compliance with the screening requirements at the time of Building Permit application. 3. A revised landscape plan shall be provided with the building permit to eliminate the conflict between trees and utilities along Sun Drive. Shrubs and perennial plantings are acceptable alternative in this area. 4. An automatic irrigation system shall be provided for all landscaped areas. All landscaped areas shall be maintained in accordance with the landscape ordinance. 5. The applicant shall submit a revised Landscape Plan and Tree Mitigation Plan that fulfills the mitigation requirement indicated above through a combination of on -site mitigation planting and/or cash dedication. 6. A photometric site lighting plan shall be provided with the Building Permit application. The plan shall strive to achieve a minimum of 0.5 footcandles of illumination throughout the parking and outdoor storage areas, with not more than 1.0 footcandle at the property lines. All fixtures shall be downcast and shielded such that the source of light is not visible from off the property. 7. The applicant shall revise the storm sewer plan to add additional storm sewer and catch basin(s) to capture the drainage before it leaves the site, in a manner acceptable to the City Engineer. 8. This development shall provide hydrant spacing and locations in accordance with City Fire Department and Public Works standards. 9. All erosion/ sediment control plans submitted for development and grading permits shall be prepared by a designer who has received current Minnesota Department of Transportation (MNDOT) training, or approved equal training as determined by the City Engineer in designing stormwater pollution prevention plans. Also, all personnel responsible for the installation of erosion/ sediment control devices, and the establishment of vegetation for the development, shall have received Erosion/Sediment Control Inspector/Installer Advisory Planning Commission March 22, 2022 Page 7 of 9 certification through the University of Minnesota, or approved equal training as determined by the City Engineer. 10. This development shall comply with Eagan’s Land Disturbance Stormwater Pollution Prevention and Post-Construction Stormwater Management Requirements (City Code Section 4.34) for stormwater management and surface water quality, including Runoff Rate Control and 1.1-inch Volume Control of effective retention of the site’s new impervious surface area (including effective soil remediation for all of the site’s disturbed soils that are to be revegetated). 11. Prior to receiving City approval to permit land disturbing activity, the applicant shall provide appropriate soil analysis to the City to evaluate and ensure suitability for infiltration of stormwater, including, but not limited to, P200 analysis of SM soils encountered below the excavation extent. If the sub-soil analysis indicates incompatibility of existing sub-soil permeability, or shallow groundwater conflict, or soil contamination, with the submitted and reviewed design plans for meeting volume control requirements, the applicant shall revise the design and/or construction plans to ensure water quality equivalent of volume control requirements are fully met for the mitigated impervious drainage area, to the satisfaction of the City Engineer. 12. The applicant shall provide adequately sized pre-treatment structure (e.g. four-foot minimum depth sump, five-foot minimum diameter, with floatable skimmer hood, energy dissipation, etc.) at, or immediately upstream of, any underground stormwater infiltration facility inlet to provide for effective capture and easily-accessible cleanout of fine-sand sized particles and floatable pollutants. Pre-treatment structures shall be accessible by appropriate maintenance equipment. Details shall be included in applicable plan sheet(s) using Eagan Standard Detail Plate E231. 13. Prior to receiving City approval to permit land disturbing activity, the applicant shall provide and include in the plan set all underground stormwater infiltration system details, including that a) an off-line bypass to prevent construction stormwater from entering the infiltration chambers shall be provided until drainage area stabilization has occured, b) solid bottom isolator row (appropriately sized) is provided at any stormwater inlet point into the underground systems, c) no limestone shall be used below or between the infiltration chambers, d) unobstructed physical access via manhole will be provided to either end of the isolator row for inspection and maintenance, e) 10-inch minimum diameter inspection ports will be provided on all infiltration chamber rows, and f) underground pipe gallery system shall be sized to fully provide instantaneous retention volume within the pipe gallery (not including the surrounding rock). Notes shall be provided that grading and utility contractor(s) shall provide 24-hours advance notice to City Water Resources staff of any grading or utility work involving the proposed infiltration pipe gallery system, including Advisory Planning Commission March 22, 2022 Page 8 of 9 over-excavation, installation of pre-treatment structures, inlets, outlets, sump skimmer hoods, etc. Shop drawings related to the underground stormwater infiltration pipe gallery system must be provided to the City for review before installation. 14. During infiltration system over-excavation/sub-soil work, the applicant shall ensure that a Certified Soil Scientist will be present to verify and document that practice area sub-soils are suitable for a saturated-state infiltration rate of no less than 0.9-inches per hour (based on 0.45-inch per hour design rate with safety factor) or greater (but less than 8.0-inch per hour). If the sub-soil infiltration rates are less than 0.9-inches per hour (or greater than 8.0- inch per hour), the applicant shall immediately notify the City Engineer and revise the volume control practice(s) design and construction as necessary (e.g. over-excavation/soil- amendment depth, etc.) to ensure volume control requirements are fully met. Verification of sub-soil infiltration testing rates shall be provided immediately to the City of Eagan on the day of infiltration testing. The applicant shall ensure that the City Water Resources staff is provided 24-hour advance notice of the occurrence of infiltration verifications and also provided notice prior to any excavation and/or soil backfilling within the infiltration practices, to arrange for inspections. 15. Prior to receiving city approval to permit land disturbing activity, the property owner shall provide detailed Soil Management Strategies in the plan set for City review, and acceptance by the City Engineer, that provide graphical details and notes on soil protection/restoration in the Stormwater Management Plan and prominently included in all applicable plan sheets (e.g. Erosion & Sediment Control Plan, Grading Plan, Landscape Plan, etc.) and shall specify estimated quantities of soil ripping area and volume of compost to be imported and incorporated on pertinent plan sheet quantity tables. Prior to receiving a Certificate of Occupancy for any affected construction, Soil Management Strategy implementation documentation (e.g. haul tickets, representative on-site soil samples, compaction testing and soil organic content test results) shall be provided to City Water Resources staff to verify approved soil management strategy compliance. Notes shall be provided that implementing contractor shall provide 24-hours advance notice to City Water Resources staff prior to implementation of soil loosening and amendment. 16. Prior to proceeding with land disturbing activity, the Property Owner shall enter into a long - term stormwater management system maintenance agreement with the City, detailing the annual inspection and maintenance required to occur to ensure proper operation and performance of the private permanent stormwater management system, in a form acceptable to the City Attorney. 17. Before the city returns any Stormwater-related Performance Guarantee Fees on the development site, the applicant shall demonstrate that all stormwater management practices are performing as intended and shall provide the City Engineer as-built plans Advisory Planning Commission March 22, 2022 Page 9 of 9 meeting City requirements for as-built standard submittals that demonstrate that all constructed stormwater conveyance structures, stormwater management facilities (sump, underground infiltration pipe gallery, etc.), including soil loosening & amendment prior to landscaping, conform to design and/or construction plans, as approved by the City. Photos/video of final inspection of clean underground infiltration pipe gallery systems and contributing storm sewer shall be provided to the City Engineer. The applicant shall su bmit to the City Engineer certification that the stormwater management facilities have been installed in accord with the plans and specifications approved. This certification shall be provided by a Professional Engineer licensed in the State of Minnesota. All voted in favor. Motion carried 4-0. V. OTHER BUSINESS VI. ADJOURNMENT Member Cherner moved, Member Francis seconded a motion to adjourn the Advisory Planning Commission meeting at 6:49 p.m. All voted in favor. Motion carried 4-0. Respectfully Submitted by: ______________________ Carol Whisnant APC Secretary PLANNING REPORT CITY OF EAGAN REPORT DATE: March 16, 2022 CASE: 08-CU-01-02-22; 08-VA-01-02-22 APPLICANT: Stanley & Wencl, LLC HEARING DATE: March 22, 2022 PROPERTY OWNER: M&L Industrial APPLICATION DATE: February 16, 2022 Properties, Inc. REQUEST: Conditional Use Permit PREPARED BY: Pam Dudziak LOCATION: 3285 Terminal Drive COMPREHENSIVE PLAN: IND, Limited Industrial ZONING: I-1, Limited Industrial SUMMARY OF REQUEST The applicant is requesting approval of a Conditional Use Permit to allow outdoor storage of one cargo container and 16 trucks, and a Variance to deviate from the building materials standards for expansion of an existing non-conforming building, upon property located at 3285 Terminal Drive, legally described as Lot 3, Block 1, Tan Me Addition. AUTHORITY FOR REVIEW Conditional Use Permit: City Code Chapter 11, Section 11.50, Subdivisions 4C and 4D provide the following. Subdivision 4C states that the Planning Commission shall recommend a conditional use permit and the Council shall issue such conditional use permits only if it finds that such use at the proposed location: 1. Will not be detrimental to or endanger the public health, safety, or general welfare of the neighborhood or the City. Planning Report – Stanley & Wencl March 22, 2022 Page 2 2. Will be harmonious with the general and applicable specific objectives of the Comprehensive Plan and City Code provisions. 3. Will be designed, constructed, operated and maintained so as to be compatible in appearance with the existing or intended character of the general vicinity and will not change the essential character of that area, nor substantially diminish or impair property values within the neighborhood. 4. Will be served adequately by essential public facilities and services, including streets, police and fire protection, drainage structures, refuse disposal, water and sewer systems and schools. 5. Will not involve uses, activities, processes, materials, equipment and conditions of operation that will be hazardous or detrimental to any persons, property or the general welfare because of excessive production of traffic, noise, smoke, fumes, glare or odors. 6. Will have vehicular ingress and egress to the property which does not create traffic congestion or interfere with traffic on surrounding public streets. 7. Will not result in the destruction, loss or damage of a natural, scenic or historic feature of major importance. 8. Is appropriate after considering whether the property is in compliance with the City Code. Subdivision 4D, Conditions, states that in reviewing applications of conditional use permits, the Planning Commission and the Council may attach whatever reasonable conditions they deem necessary to mitigate anticipated adverse impacts associated with these uses, to protect the value of other property within the district, and to achieve the goals and objectives of the Comprehensive Plan. In all cases in which conditional uses are granted, the Council shall require such evidence and guarantees as it may deem necessary as proof that the conditions stipulated in connection therewith are being and will be complied with. Variance: City Code Chapter 11, Section 11.50, Subdivision 3, B., 3, states that the Council may approve, approve with conditions or deny a request for a variance. In considering all requests for a variance, and whether the applicant established that there are practical difficulties in complying with the provisions(s) of this Chapter, the City Council shall consider the following factors: a. Exceptional or extraordinary circumstances apply to the property which do not apply generally to other properties in the same zone or vicinity, and result from lot size or Planning Report – Stanley & Wencl March 22, 2022 Page 3 shape, topography, or other circumstances over which the owner of property has no control. b. The literal interpretation of the provisions of this Code would deprive the applicant property use commonly enjoyed by other properties in the same district under the provisions of this Code. c. The exceptional or extraordinary circumstances do not result from the actions of the applicant. d. The granting of the variance will not confer on the applicant any special privilege that is denied by this Chapter to owners of other lands, structures or buildings in the same district. e. The variance requested is the minimum variance which would alleviate the practical difficulties. f. The variance would not be materially detrimental to the purposes of this Code or to properties in the same zone. g. The property for which the variance is requested is otherwise in compliance with the City Code. The ordinance also states “A variance will be denied when it is not in harmony with the general purposes and intent of the zoning provisions of this Code or when the variance is inconsistent with the comprehensive plan. Any condition imposed upon the approved variance must be directly related to and must bear a rough proportionality to the impact created by the variance.” BACKGROUND/HISTORY Tan Me Industrial Park was platted in 1996. The two-acre site contains a 12,004 square foot office/warehouse building, constructed in 2001. A Conditional Use Permit (CUP) was approved in 2009 allowing outdoor storage of trucks, semi-tractors, trailers and other commercial vehicles on the property. Pursuant to the 2009 CUP, a chain link fence with mesh screen panels was installed, an informal driveway to Terminal Drive at the south end of the parcel was closed, and additional landscaping was added to the site. EXISTING CONDITIONS The property is located on the southwest corner of Terminal Drive and Sun Drive. Terminal Drive is public right-of-way, while Sun Drive is a private street. Access is from Sun Drive in two locations. The building is served by City water and sanitary sewer. Mature trees are located Planning Report – Stanley & Wencl March 22, 2022 Page 4 around the perimeter of the property. The existing 12,004 square foot building is located on the northern part of the site, with parking along the front of the building. The approved outdoor storage area is in the south and west portion of the property. SURROUNDING USES The site is surrounded by properties zoned and guided for industrial use. Outdoor storage is also common in this area. EVALUATION OF REQUEST Description of Proposal – The applicant is proposing to construct a 11,684 square foot addition south of the existing building. The building addition will displace some of the existing outdoor storage area and require additional parking to support the larger building. Total building area will be 23,688 square feet, with a ratio of 25 percent office and 75 percent warehouse space, requiring 67 parking stalls. If approved, the new CUP would replace the 2009 CUP. The addition is proposed to be constructed of the same finish materials as the existing building, which predates the City’s exterior materials ordinance and is non-conforming in that regard. Therefore, the addition would need to meet current City Code standards and the two portions of the building would not match or the existing building finish would need to be modified. The Variance is requested to allow the new addition to match the existing and not adhere to current City Code standards for exterior materials. Compatibility with Surrounding Area – Outdoor storage is a conditional use in the I-1 zoning district. The proposed use appears compatible with surrounding properties and existing uses. Airport Noise Considerations – This property is located within the Aircraft Noise Zone Overlay District one-mile Zone 4 Buffer. Within this area, industrial uses are considered compatible. Site Plan – The building is proposed to be expanded to the south, with parking along the front of the building also expanded to the south, and a new driveway to Terminal Drive added at the south end of the front parking lot. A fenced enclosure is located in the southwest corner of the lot, as was required with the 2009 CUP approval. Parking and outdoor storage is located on the west side of the building. A total of 67 stalls are provided by design. Eight spaces for truck parking are available along the building at the loading docks. The applicant is proposing a total of 17 outdoor storage spaces on the property consisting of 8 stalls along the building at loading docks, 8 stalls along the west property line, and 1 stall along the south property line for a cargo container/storage box used for yard care and seasonal equipment. A 20-yard dumpster is located within the mesh-screened fence enclosure at the southwest corner of the lot, approved as part of the 2009 CUP, will remain. Planning Report – Stanley & Wencl March 22, 2022 Page 5 In addition to the requirements for a conditional use permit listed above, City Code Section 11.70, Subdivision 22, C, 2, lists performance standards for outdoor storage as follows: a. Outdoor storage items shall be placed within an enclosure as necessary to achieve appropriate security and containment or for public safety reasons when determined necessary by the city. In general business (GB) and community shopping center (CSC) zoning districts, the enclosure shall be attached to the principal building and be constructed of materials which are aesthetically compatible with the principal building. In limited industrial (I-1) and general industrial (I-2) zoning districts, the enclosure may be detached from the principal building. The rear yard area is fenced along the west side and an eight-foot tall retaining wall will be constructed along the south side. A fence with mesh screening is present along the east side of the property, and only the driveway remains open. b. The storage area shall be located in the side or rear yards and shall not encroach into any required front building setback area or other required setbacks. The outdoor storage is located in the rear yard and satisfies minimum required setbacks, which is five feet from the side and rear lot lines, 20 feet from Sun Drive. c. The outdoor storage area shall be screened from view from the public right-of- way and from any adjacent property which is designated for residential uses in the comprehensive guide plan. The building screens the storage area from Terminal Drive. The outdoor storage is visible through the open driveway from Sun Drive. Existing landscaping screens the rear parking and storage area from Sun Drive, and a chain link fence with mesh provides screening at the northwest corner of the lot. All outdoor storage items, and the cargo container in particular, should be maintained in a well kept manner. The 20-yard dumpster should be maintained consistent with City Code standards for trash receptacles, with a cover and drain plug in place. d. The storage area shall not interfere with any pedestrian or vehicular movement. The proposed storage areas are along the perimeter of the site and do not appear to interfere with pedestrian or vehicular movement. e. The storage area shall not take up required parking spaces or landscaping areas. With 17 spaces designated for outdoor storage, 8 trucks and the cargo container occupy 9 of the 67 parking stalls. The other eight truck parking spaces are at loading docks against the building. Required minimum parking is 67 stalls. Thus, the outdoor storage does not satisfy this standard. Planning Report – Stanley & Wencl March 22, 2022 Page 6 The stated employee parking need is 52 stalls. With nine stalls occupied by the outdoor storage trucks, leaving six stalls available for visitors. The applicant has identified the truck and container storage stalls as proof of parking and indicates that the trucks are stored on site overnight and leave the site during the day making those stalls available for employee parking during the day. Availability of the required parking stalls depends on operational management of the site. If the City determines that the parking is necessary, the proof of parking plan must be implemented and the owner will be compelled to remove the outdoor storage from the property to provide the required proof of parking stalls. f. The storage area shall be surfaced with concrete or an approved equivalent to control dust and erosion. The surface shall be properly maintained to prevent deterioration. The plans show the front parking lot and the rear parking and storage lot are to be surfaced with bituminous asphalt and edged with concrete curb and gutter. Bulk Standards – Within the I-1 zoning district, a maximum 35 percent building coverage ratio is allowed, and a minimum of 25 percent green space must be maintained. Maximum allowable structure height is 40 feet, and minimum side and rear yard building setbacks are 20 feet. The submitted plans do comply with all of these standards. A summary of these standards as required and proposed is as follows: Required Proposed Front Yard Setback (Terminal Dr.) 30 feet minimum 73 feet Side Yard Setback 20 feet minimum 20 feet (south) Rear Yard Setback 20 feet minimum >100 feet (west) Building Height 40 feet maximum 21 feet Building Coverage 35 percent maximum 25 percent Green Space 25 percent minimum 28.1 percent Variance – The existing building finish is a textured raked concrete panel. The raked concrete panel finish is a Class III material and the City’s ordinance requires industrial buildings less than 800 feet from a state right-of-way (State Highway 13 is about 700 feet away from this parcel, with intervening properties between the highway and subject property) to have at least two Class I (e.g. brick, glass, natural stone) or Class II (e.g. specialty concrete block, stucco, manufactured stone) materials comprising at least 65 percent of the finish, and not more than 35 percent Class III materials (e.g. precast concrete panels, EIFS, cement-based siding, glass block). The ordinance allows expansions of nonconforming buildings to match the existing when the expansion is less than 10,000 square feet and 50 percent of the size of the existing building. In this case, since the expansion exceeds these parameters, it would need to meet current code standards. The applicant is requesting a Variance to construct the addition with a matching exterior to present a cohesive appearance to the overall building. Planning Report – Stanley & Wencl March 22, 2022 Page 7 Mechanical Equipment – City Code requires all rooftop and ground mounted mechanical equipment to be fully screened from public view and from adjacent properties. New rooftop equipment must be located 20 feet from the edge of the roof. The existing building predates the City’s mechanical screening ordinance and was constructed without a parapet. Existing rooftop mechanical units are partially visible from off the property. An addition to the building that matches the existing would also lack the parapet typically required of new construction. Therefore, other means may be employed to accomplish screening of rooftop equipment. The ordinance allows for a physical screen that is visually integrated with the principal structure in terms of materials, color, shape and size, to be installed around the equipment. All new and existing mechanical equipment should be shown on the Building Elevations plan, and the applicant should demonstrate compliance with the screening requirements at the time of Building Permit application. Site Lighting – Lighting is required as necessary for security, safety and traffic circulation. Illumination should be indirect and diffused or shielded. Lighting should not be directed upon public rights-of-way or adjacent property and the source of light should not be visible from off the property. The submitted plans show an acceptable LED building mounted light fixture, however, a photometric plan was not provided showing the extent of illumination such lights provide on the site, particularly to the outer edges of the parking and outdoor storage lots. A photometric site lighting plan should be provided with the Building Permit application. The plan should strive to achieve a minimum of 0.5 footcandles of illumination throughout the parking and outdoor storage areas, with not more than 1.0 footcandle at the property lines. All fixtures should be downcast and shielded such that the source of light is not visible from off the property. Landscaping – The site was landscaped as a condition of the 2009 Conditional Use Permit. Some of the existing trees and other landscaping will be removed for the expansion. A new landscape plan was provided showing foundation plantings along the front of the building and several new trees along Sun Drive. An existing row of amur maples south of the Sun Drive access will remain. The proposed new trees along Sun Drive conflict with underground water main and storm sewer pipes. Several trees along Terminal Drive and at the southwest edge of the site will remain. A revised landscape plan should be provided with the building permit to eliminate the conflict between trees and utilities along Sun Drive. Shrubs and perennial type plantings are an acceptable alternative in that area. An automatic irrigation system should be provided for all landscaped areas to ensure long-term viability and health of plant materials. In accordance with the landscape ordinance, all landscaped areas must be maintained including regular watering, replacement of damaged diseased or dead plants, and weed control. Planning Report – Stanley & Wencl March 22, 2022 Page 8 Tree Preservation– Previous development of the site in 2009 resulted in the required mitigation of twenty-five (25) category “B” trees. Therefore, future development applications are subject to zero allowable removal. The 25 previously installed mitigation trees are primarily white pine and black hills spruce planted along the southern property boundary, and southwestern property corner. The current application, proposes the removal of 20 of the previously planted mitigation trees as shown on the Tree Removal and Preservation Plan on sheet L100. Since the allowable removal threshold for this site has been exceeded, the removals must be mitigated. The trees are in fair condition, however are not significant by size and staff are recommending a replacement ratio of 1:1. The applicant should provide on-site mitigation to the extent possible and provide a cash dedication for the balance. The applicant shall submit a revised Landscape Plan and Tree Mitigation Plan that fulfills the mitigation requirement indicated above through a combination of on-site mitigation planting and/or cash dedication. Issuance of a conditional use permit does not imply an exemption from future tree preservation requirements. Future development is subject to conditions of the tree preservation ordinance and must be satisfied prior to plan approval. Grading/Storm Drainage – The western one-third of the parcel will be graded to prepare the site for a building expansion, paving of the parking lots, and creation of an underground stormwater treatment chambers. No storm sewer catch basins are currently located in in the existing parking lot on the northwest side of the building, and no new catch basins are proposed in the expansion. All the runoff from the 0.7-acre northwestern parking lot will run into Sun Drive. The applicant should revise the storm sewer plan to add additional storm sewer and catch basin(s) to capture the drainage before it leaves the site, in a manner acceptable to the City Engineer. Wetlands – No wetlands are on the site, therefore, City Code Section 11.67, wetland protection and management regulations, does not apply. Stormwater Management/ Water Quality – The applicant proposes to construct new/fully- reconstructed impervious surfaces totaling 0.76 acres, with additional areas of disturbed/graded soils that are to be revegetated, on the site. This development will need to comply with the City’s Land Disturbance Stormwater Pollution Prevention and Post- Construction Stormwater Management Requirements (City Code Section 4.34) for stormwater management and surface water quality, including Runoff Rate Control and 1.1-inch Volume Control. To meet the 1.1-inch Volume Control requirement for this development proposal, based on 0.76 acres of impervious surface, a minimum of 3,035 cubic feet of effective retention Planning Report – Stanley & Wencl March 22, 2022 Page 9 will need to be provided (if included with an acceptable Soil Management Strategy for any disturbed/graded areas proposed to be revegetated, to restore soil permeability and soil health). The applicant proposes to meet City stormwater rate control and volume control requirements through the on-site construction of one underground stormwater perforated pipe gallery for infiltration, with three pre-treatment sump structures, for rate control and volume control with a total retention volume/water quality equivalent of 3,494 cubic feet. Sub-soil borings were provided that indicated that infiltration is possible within at least 50 percent of the footprint of the underground infiltration system. Overflow from the stormwater management system would discharge into the public storm sewer system along Sun Drive and then into public waterbody CP-8, then into the Minnesota River floodplain. Eagan Water Resources has reviewed the applicant’s submitted plans and stormwater management report, and finds the proposed plans meet City Code Section 4.34 Post- Construction Stormwater Management Requirements with the following conditions to provide: • appropriate erosion and sediment control during construction across the site during the extent of all construction activities (including effective rapid stabilization protections, construction stormwater treatment and sedimentation containment, rapid cleanup of tracking, etc.) to protect downstream waterbodies from construction stormwater • appropriate sub-soil exploration and evaluation to ensure that sub-soils are suitable for the infiltration of stormwater • appropriate design and implementation of the underground infiltration system • appropriate inspection and maintenance access for the underground infiltration systems • appropriate pre-treatment structures upstream of any underground system inlet, for sediment/debris/pollutant collection and easy cleanout accessibility • adequate protection of the underground infiltration system during install through site full stabilization • assurances of long-term recurring maintenance of all private stormwater management facilities • effective soil loosening and amendment of all graded soils to be revegetated Utilities – The existing building is connected to the City sanitary sewer and water main systems. No additional connections or modifications are proposed with this application. However, the hydrant coverage does not appear to meet current City standards. This development should provide hydrant spacing and locations in accordance with City Fire Department and Public Works standards. Also, a hydrant will need to be located within 100 feet of the Fire Department Connection. Planning Report – Stanley & Wencl March 22, 2022 Page 10 Streets/ Access/ Circulation – Access will remain at the two existing entrances onto the private street of Sun Drive. A new public street access is proposed onto Terminal Drive. Financial Obligation – At this time, there are no pending assessments on the parcel, and all trunk and lateral utility fees have been previously paid. Parks and Recreation – Park and trail dedication were previously satisfied for this property. The increase in building size and proposal does not impact the parks or trail system. SUMMARY/CONCLUSION The applicant is proposing to construct an addition to the existing building, increasing the required amount of parking associated with a larger building and displacing some of the existing outdoor storage on the site. The applicant is requesting approval of a new Conditional Use Permit for the outdoor storage of 16 trucks and 1 cargo container used for property maintenance equipment. An existing 20-yard dumpster on the southeast corner which was allowed pursuant to the 2009 CUP also will remain. This proposal would replace the existing 2009 CUP. The proposed outdoor storage meets most of the performance standards in the ordinance, however, occupies nine required parking stalls shown as proof of parking. Previously installed mitigation trees that are removed should be replaced, and cash dedication provided for any tree replacment that cannot fit on site. A Variance is also requested to allow the exterior finish of the addition to match the existing non-conforming building, which predates the City’s building materials ordinance. The proposal appears to satisfy other City Code standards, which will be reviewed and confirmed with the building permit application. ACTION TO BE CONSIDERED To recommend approval of a Conditional Use Permit to allow outdoor storage of one cargo container and 16 trucks, and including one 20-yard dumpster, upon property located at 3285 Terminal Drive, legally described as Lot 3, Block 1, Tan Me Addition. If approved the following conditions shall apply: 1. This Conditional Use Permit shall be recorded at Dakota County within 60 days of approval by the City Council. 2. This Conditional Use Permit allows the outdoor storage of 16 trucks, one cargo container, and one 20-yard dumpster on the property. Outdoor storage is limited only to those items in the locations and quantities indicated on the approved Site Plan received March 8, 2022. Planning Report – Stanley & Wencl March 22, 2022 Page 11 3. If the City determines that all required parking is necessary, the proof of parking plan shall be implemented and the owner will be compelled to remove the outdoor storage from the property to provide the required proof of parking. 4. All outdoor storage items, and the cargo container in particular, shall be maintained in a well kept manner. The 20-yard dumpster shall be maintained consistent with City Code standards for trash receptacles, with a cover and drain plug in place. 5. All new and existing mechanical equipment shall be shown on the Building Elevations plan, and the applicant shall demonstrate compliance with the screening requirements at the time of Building Permit application. 6. A revised landscape plan shall be provided with the building permit to eliminate the conflict between trees and utilities along Sun Drive. Shrubs and perennial plantings are acceptable alternative in this area. 7. An automatic irrigation system shall be provided for all landscaped areas. All landscaped areas shall be maintained in accordance with the landscape ordinance. 8. The applicant shall submit a revised Landscape Plan and Tree Mitigation Plan that fulfills the mitigation requirement indicated above through a combination of on-site mitigation planting and/or cash dedication. 9. A photometric site lighting plan shall be provided with the Building Permit application. The plan shall strive to achieve a minimum of 0.5 footcandles of illumination throughout the parking and outdoor storage areas, with not more than 1.0 footcandle at the property lines. All fixtures shall be downcast and shielded such that the source of light is not visible from off the property. 10. The applicant shall revise the storm sewer plan to add additional storm sewer and catch basin(s) to capture the drainage before it leaves the site, in a manner acceptable to the City Engineer. 11. This development shall provide hydrant spacing and locations in accordance with City Fire Department and Public Works standards. 12. All erosion/ sediment control plans submitted for development and grading permits shall be prepared by a designer who has received current Minnesota Department of Transportation (MNDOT) training, or approved equal training as determined by the City Engineer in designing stormwater pollution prevention plans. Also, all personnel responsible for the installation of erosion/ sediment Planning Report – Stanley & Wencl March 22, 2022 Page 12 control devices, and the establishment of vegetation for the development, shall have received Erosion/Sediment Control Inspector/Installer certification through the University of Minnesota, or approved equal training as determined by the City Engineer. 13. This development shall comply with Eagan’s Land Disturbance Stormwater Pollution Prevention and Post-Construction Stormwater Management Requirements (City Code Section 4.34) for stormwater management and surface water quality, including Runoff Rate Control and 1.1-inch Volume Control of effective retention of the site’s new impervious surface area (including effective soil remediation for all of the site’s disturbed soils that are to be revegetated). 14. Prior to receiving City approval to permit land disturbing activity, the applicant shall provide appropriate soil analysis to the City to evaluate and ensure suitability for infiltration of stormwater, including, but not limited to, P200 analysis of SM soils encountered below the excavation extent. If the sub-soil analysis indicates incompatibility of existing sub-soil permeability, or shallow groundwater conflict, or soil contamination, with the submitted and reviewed design plans for meeting volume control requirements, the applicant shall revise the design and/or construction plans to ensure water quality equivalent of volume control requirements are fully met for the mitigated impervious drainage area, to the satisfaction of the City Engineer. 15. The applicant shall provide adequately sized pre-treatment structure (e.g. four- foot minimum depth sump, five-foot minimum diameter, with floatable skimmer hood, energy dissipation, etc.) at, or immediately upstream of, any underground stormwater infiltration facility inlet to provide for effective capture and easily- accessible cleanout of fine-sand sized particles and floatable pollutants. Pre- treatment structures shall be accessible by appropriate maintenance equipment. Details shall be included in applicable plan sheet(s) using Eagan Standard Detail Plate E231. 16. Prior to receiving City approval to permit land disturbing activity, the applicant shall provide and include in the plan set all underground stormwater infiltration system details, including that a) an off-line bypass to prevent construction stormwater from entering the infiltration chambers shall be provided until drainage area stabilization has occured, b) solid bottom isolator row (appropriately sized) is provided at any stormwater inlet point into the underground systems, c) no limestone shall be used below or between the infiltration chambers, d) unobstructed physical access via manhole will be provided to either end of the isolator row for inspection and maintenance, e) 10- inch minimum diameter inspection ports will be provided on all infiltration chamber rows, and f) underground pipe gallery system shall be sized to fully Planning Report – Stanley & Wencl March 22, 2022 Page 13 provide instantaneous retention volume within the pipe gallery (not including the surrounding rock). Notes shall be provided that grading and utility contractor(s) shall provide 24-hours advance notice to City Water Resources staff of any grading or utility work involving the proposed infiltration pipe gallery system, including over-excavation, installation of pre-treatment structures, inlets, outlets, sump skimmer hoods, etc. Shop drawings related to the underground stormwater infiltration pipe gallery system must be provided to the City for review before installation. 17. During infiltration system over-excavation/sub-soil work, the applicant shall ensure that a Certified Soil Scientist will be present to verify and document that practice area sub-soils are suitable for a saturated-state infiltration rate of no less than 0.9-inches per hour (based on 0.45-inch per hour design rate with safety factor) or greater (but less than 8.0-inch per hour). If the sub-soil infiltration rates are less than 0.9-inches per hour (or greater than 8.0-inch per hour), the applicant shall immediately notify the City Engineer and revise the volume control practice(s) design and construction as necessary (e.g. over- excavation/soil-amendment depth, etc.) to ensure volume control requirements are fully met. Verification of sub-soil infiltration testing rates shall be provided immediately to the City of Eagan on the day of infiltration testing. The applicant shall ensure that the City Water Resources staff is provided 24-hour advance notice of the occurrence of infiltration verifications and also provided notice prior to any excavation and/or soil backfilling within the infiltration practices, to arrange for inspections. 18. Prior to receiving city approval to permit land disturbing activity, the property owner shall provide detailed Soil Management Strategies in the plan set for City review, and acceptance by the City Engineer, that provide graphical details and notes on soil protection/restoration in the Stormwater Management Plan and prominently included in all applicable plan sheets (e.g. Erosion & Sediment Control Plan, Grading Plan, Landscape Plan, etc.) and shall specify estimated quantities of soil ripping area and volume of compost to be imported and incorporated on pertinent plan sheet quantity tables. Prior to receiving a Certificate of Occupancy for any affected construction, Soil Management Strategy implementation documentation (e.g. haul tickets, representative on-site soil samples, compaction testing and soil organic content test results) shall be provided to City Water Resources staff to verify approved soil management strategy compliance. Notes shall be provided that implementing contractor shall provide 24-hours advance notice to City Water Resources staff prior to implementation of soil loosening and amendment. 19. Prior to proceeding with land disturbing activity, the Property Owner shall enter into a long-term stormwater management system maintenance agreement with Planning Report – Stanley & Wencl March 22, 2022 Page 14 the City, detailing the annual inspection and maintenance required to occur to ensure proper operation and performance of the private permanent stormwater management system, in a form acceptable to the City Attorney. 20. Before the city returns any Stormwater-related Performance Guarantee Fees on the development site, the applicant shall demonstrate that all stormwater management practices are performing as intended and shall provide the City Engineer as-built plans meeting City requirements for as-built standard submittals that demonstrate that all constructed stormwater conveyance structures, stormwater management facilities (sump, underground infiltration pipe gallery, etc.), including soil loosening & amendment prior to landscaping, conform to design and/or construction plans, as approved by the City. Photos/video of final inspection of clean underground infiltration pipe gallery systems and contributing storm sewer shall be provided to the City Engineer. The applicant shall submit to the City Engineer certification that the stormwater management facilities have been installed in accord with the plans and specifications approved. This certification shall be provided by a Professional Engineer licensed in the State of Minnesota To recommend approval of a Variance to deviate from the building materials standards for expansion of an existing non-conforming building, upon property located at 3285 Terminal Drive, legally described as Lot 3, Block 1, Tan Me Addition. 1. If within one year after approval, the variance shall not have been completed or utilized, it shall become null and void unless a petition for extension has been granted by the council. Such extension shall be requested in writing at least 30 days before expiration and shall state facts showing a good faith attempt to complete or utilize the use permitted in the variance. 2. All new and existing mechanical equipment shall be shown on the Building Elevations plan, and the applicant shall demonstrate compliance with the screening requirements at the time of Building Permit application. 3. A revised landscape plan shall be provided with the building permit to eliminate the conflict between trees and utilities along Sun Drive. Shrubs and perennial plantings are acceptable alternative in this area. 4. An automatic irrigation system shall be provided for all landscaped areas. All landscaped areas shall be maintained in accordance with the landscape ordinance. Planning Report – Stanley & Wencl March 22, 2022 Page 15 5. The applicant shall submit a revised Landscape Plan and Tree Mitigation Plan that fulfills the mitigation requirement indicated above through a combination of on-site mitigation planting and/or cash dedication. 6. A photometric site lighting plan shall be provided with the Building Permit application. The plan shall strive to achieve a minimum of 0.5 footcandles of illumination throughout the parking and outdoor storage areas, with not more than 1.0 footcandle at the property lines. All fixtures shall be downcast and shielded such that the source of light is not visible from off the property. 7. The applicant shall revise the storm sewer plan to add additional storm sewer and catch basin(s) to capture the drainage before it leaves the site, in a manner acceptable to the City Engineer. 8. This development shall provide hydrant spacing and locations in accordance with City Fire Department and Public Works standards. 9. All erosion/ sediment control plans submitted for development and grading permits shall be prepared by a designer who has received current Minnesota Department of Transportation (MNDOT) training, or approved equal training as determined by the City Engineer in designing stormwater pollution prevention plans. Also, all personnel responsible for the installation of erosion/ sediment control devices, and the establishment of vegetation for the development, shall have received Erosion/Sediment Control Inspector/Installer certification through the University of Minnesota, or approved equal training as determined by the City Engineer. 10. This development shall comply with Eagan’s Land Disturbance Stormwater Pollution Prevention and Post-Construction Stormwater Management Requirements (City Code Section 4.34) for stormwater management and surface water quality, including Runoff Rate Control and 1.1-inch Volume Control of effective retention of the site’s new impervious surface area (including effective soil remediation for all of the site’s disturbed soils that are to be revegetated). 11. Prior to receiving City approval to permit land disturbing activity, the applicant shall provide appropriate soil analysis to the City to evaluate and ensure suitability for infiltration of stormwater, including, but not limited to, P200 analysis of SM soils encountered below the excavation extent. If the sub-soil analysis indicates incompatibility of existing sub-soil permeability, or shallow groundwater conflict, or soil contamination, with the submitted and reviewed design plans for meeting volume control requirements, the applicant shall revise the design and/or construction plans to ensure water quality equivalent of Planning Report – Stanley & Wencl March 22, 2022 Page 16 volume control requirements are fully met for the mitigated impervious drainage area, to the satisfaction of the City Engineer. 12. The applicant shall provide adequately sized pre-treatment structure (e.g. four- foot minimum depth sump, five-foot minimum diameter, with floatable skimmer hood, energy dissipation, etc.) at, or immediately upstream of, any underground stormwater infiltration facility inlet to provide for effective capture and easily- accessible cleanout of fine-sand sized particles and floatable pollutants. Pre- treatment structures shall be accessible by appropriate maintenance equipment. Details shall be included in applicable plan sheet(s) using Eagan Standard Detail Plate E231. 13. Prior to receiving City approval to permit land disturbing activity, the applicant shall provide and include in the plan set all underground stormwater infiltration system details, including that a) an off-line bypass to prevent construction stormwater from entering the infiltration chambers shall be provided until drainage area stabilization has occured, b) solid bottom isolator row (appropriately sized) is provided at any stormwater inlet point into the underground systems, c) no limestone shall be used below or between the infiltration chambers, d) unobstructed physical access via manhole will be provided to either end of the isolator row for inspection and maintenance, e) 10- inch minimum diameter inspection ports will be provided on all infiltration chamber rows, and f) underground pipe gallery system shall be sized to fully provide instantaneous retention volume within the pipe gallery (not including the surrounding rock). Notes shall be provided that grading and utility contractor(s) shall provide 24-hours advance notice to City Water Resources staff of any grading or utility work involving the proposed infiltration pipe gallery system, including over-excavation, installation of pre-treatment structures, inlets, outlets, sump skimmer hoods, etc. Shop drawings related to the underground stormwater infiltration pipe gallery system must be provided to the City for review before installation. 14. During infiltration system over-excavation/sub-soil work, the applicant shall ensure that a Certified Soil Scientist will be present to verify and document that practice area sub-soils are suitable for a saturated-state infiltration rate of no less than 0.9-inches per hour (based on 0.45-inch per hour design rate with safety factor) or greater (but less than 8.0-inch per hour). If the sub-soil infiltration rates are less than 0.9-inches per hour (or greater than 8.0-inch per hour), the applicant shall immediately notify the City Engineer and revise the volume control practice(s) design and construction as necessary (e.g. over- excavation/soil-amendment depth, etc.) to ensure volume control requirements are fully met. Verification of sub-soil infiltration testing rates shall be provided immediately to the City of Eagan on the day of infiltration testing. The applicant Planning Report – Stanley & Wencl March 22, 2022 Page 17 shall ensure that the City Water Resources staff is provided 24-hour advance notice of the occurrence of infiltration verifications and also provided notice prior to any excavation and/or soil backfilling within the infiltration practices, to arrange for inspections. 15. Prior to receiving city approval to permit land disturbing activity, the property owner shall provide detailed Soil Management Strategies in the plan set for City review, and acceptance by the City Engineer, that provide graphical details and notes on soil protection/restoration in the Stormwater Management Plan and prominently included in all applicable plan sheets (e.g. Erosion & Sediment Control Plan, Grading Plan, Landscape Plan, etc.) and shall specify estimated quantities of soil ripping area and volume of compost to be imported and incorporated on pertinent plan sheet quantity tables. Prior to receiving a Certificate of Occupancy for any affected construction, Soil Management Strategy implementation documentation (e.g. haul tickets, representative on-site soil samples, compaction testing and soil organic content test results) shall be provided to City Water Resources staff to verify approved soil management strategy compliance. Notes shall be provided that implementing contractor shall provide 24-hours advance notice to City Water Resources staff prior to implementation of soil loosening and amendment. 16. Prior to proceeding with land disturbing activity, the Property Owner shall enter into a long-term stormwater management system maintenance agreement with the City, detailing the annual inspection and maintenance required to occur to ensure proper operation and performance of the private permanent stormwater management system, in a form acceptable to the City Attorney. 17. Before the city returns any Stormwater-related Performance Guarantee Fees on the development site, the applicant shall demonstrate that all stormwater management practices are performing as intended and shall provide the City Engineer as-built plans meeting City requirements for as-built standard submittals that demonstrate that all constructed stormwater conveyance structures, stormwater management facilities (sump, underground infiltration pipe gallery, etc.), including soil loosening & amendment prior to landscaping, conform to design and/or construction plans, as approved by the City. Photos/video of final inspection of clean underground infiltration pipe gallery systems and contributing storm sewer shall be provided to the City Engineer. The applicant shall submit to the City Engineer certification that the stormwater management facilities have been installed in accord with the plans and specifications approved. This certification shall be provided by a Professional Engineer licensed in the State of Minnesota. YANKEEDRIVEF A R N U M DONALD AVEB O A R D W A L KSTATE TRUNK HWY. NO. 13BLA CK HA W K R O A D DONALD CO U RTASHBURY ROAD MEADOW VIEW ROAD DONALD AVELETENDRE ST BIRCHPONDRDALEXAND ERRD DRIVE LETENDRE ST ST.CHARLESPLACEALDENPONDLANECOACHMANROADTERMINALDRIVEHUNT DRIVE COACHMANROADCOAC H MANROADC O M A N C H E R O A D BOARDWALKCOUNTY ROAD NO. 28 (YANKEE DOODLE ROAD) FOUR OAKS RD M C C A R T H Y R O A D COAC H MANROADHERITAGELANECOACHMANROADBLUE CROSS RD.YANKEE D O O D LE R O A D BLUECROSSROADSKYLINECENTURY POINT MCCART H Y R D STATETRUNKHIGHWAYNO.13BALTICAVESTATEHIGHWAYNO.13KENNEBEC DRIVESky Hill Park QuarryPark Fort SnellingState Park Location Map 0 1,000500 Feet ´ §¨¦35E §¨¦494 Cliff Rd Diffley Rd Yankee Doodle Rd Lone Oak Rd Map Area Extent Project Name: Stanley & WenclRequest: Conditional Use Permit VarianceFile Nos.: 08-CU-01-02-2208-VA-01-02-22 Subject Site MN HWY 13MN HWY 13MN HWY 13Heritage LaneTerminal DriveDonald AvenueLetendre Street Yankee Doodle RoadTerminal Drive0 500250 Feet ´This map is for reference use only. This is not a survey and is not indtended to be used as one. Aerial photo-Spring 2021 Project Name: Stanley & Wencl, LLCRequest: Conditional Use Permit; VarianceFile Nos.: 08-CU-01-02-22; 08-VA-01-02-22 Terminal DriveTerminal Drive0 200100 Feet ´This map is for reference use only. This is not a survey and is not indtended to be used as one. Aerial photo-Spring 2021 Project Name: Stanley & Wencl, LLCRequest: Conditional Use Permit; VarianceFile Nos.: 08-CU-01-02-22; 08-VA-01-02-22 R olf LokensgardArchitecture IncR olf LokensgardArchitecture IncRevisions:____________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________ALL CONTRACTORSANDSUBCONTRACTORS SHALL VERIFY ALLCONDITIONS AND DIMENSIONS AT THEBUILDING AND/OR SITE.3285 Terminal DriveEagan, MNI hereby certify that this plan, specificationor report was prepared by me or under mydirect supervision and that I am a dulyLicensed Architect under thelaws of the State of Minnesota._______________________________________Rolf LokensgardDate_____________Registration No.________AdditionTerminal Business CenterPreliminaryNot for construction3932 Stonebridge Dr N Suite 100St. Paul, Minnesota 55123651 452 3251www.rolflokensgard.comrolf@rolflokensgard.com8.31.2021 SCHEMATIC REVIEW2.16.2022 CUP SUBMITTALPlans and specifications are the property of Stanley& Wencl, LLC. No reproduction or sharing of thesedocuments is allowed without the express writtenpermission from an officer of Stanley & Wencl, LLC.0 100 20000300 feet300 feet31'-4"31'-4"31'-4"32'-0"32'-0"32'-0"20'-0"10'-0"19'-0"5'-0"20'-0" 18'-0" 25'-0" 10'-0"5'-0"28'-0"94'-0"124'-0"128'-0"32'-0"32'-0"32'-0"32'-0"10'-0"MIN10'-0"2'-0" 10'-0"1'-0"8'-0"8'-0" 8'-0" 8'-0"18'-9"26'-0"8'-0"18'-5" 19'-0" 19'-0" 18'-5 1/2"26'-0"36'-0"40'-8"20'-9"23431312,004 sq ft11,684 sq ft3,709 sq ft6,016 sq ft23 PARKINGSPACES20 YARDDUMPSTERRAMPRAMPNEW CONCRETE CURB AND GUTTERNEW CONCRETE CURB AND GUTTER6 FT CHAIN LINK FENCEWITH MESH PER C.U.P.NEW BITUMINOUS EXISTING BITUMINOUSTERMINAL DRIVESUN DRIVENEW BITUMINOUS EXISTING BITUMINOUSNEWCONCRETECURB ANDGUTTERSTORAGE BOX2TRUCK STORAGE AT NIGHTPARKING DURING DAY53331823CONC APRON10 PARKING 20 A OWNER 2 B 2 EMPLOYEES 30 C-G 30 EMPLOYEES 12 VISITORS 64 TOTAL 35 23 67 TOTAL REQUIRED BY ZONING 9 TRUCK PROOF OF PARKING 58 TOTAL DESIGNED HOURS OF OPERATON 7 AM TO 5 PM2030 EMPLOYEES55 PARKING SPACES2 EMPLOYEES20 PARKINGSPACESABCDEFG81ELECTRICELECTRICELECTRIC6789DCBA43215NEW TENANTEXISTING TENANTEXISTINGSITE DATALOT 3, BLOCK 1, TAN ME INDUSTRIAL PARK, DAKOTA COUNTY, MINNESOTALOT AREA: 94,443 SF 2.17 ACRES94443 – 4092 Sun Drive = 90351ZONING AND LAND USE: I-2 LIGHT INDUSTRIALMIN BUILDING SETBACKS40’-0” SETBACK FROM PUBLIC RIGHT-OF-WAY20’-0” SIDE YARD SETBACK20’-0” REAR YARD SETBACK40’-0” STRUCTURE HEIGHT MAX. 21 FT DESIGNED.50’-0” Building and outdoor storage setback adjacent to properties guided* for residential or public use when properties are separated by a street, or when directly abutting property guided by Park and Public Facilities.35% BUILDING COVERAGE MAX 25% DESIGNED 1.65 ACRES = (75%) IMPERVIOUS AREA 1.56 ACRES = (72%) IMPERVIOUS AREA EXCLUDING SUN DRIVE.25%GREEN SPACE REQUIRED28.1% DESIGNEDPARKING12004 SF PHASE I11684 SF PHASE II23,688 SF TOTAL5922 TOTAL OFFICE (25%)40 5922/15017766 TOTAL WAREHOUSE15 6000/40012 11759/100067 TOTAL PARKING SPACES REQUIRED-9 TRUCK PROOF OF PARKING, STORAGE BOX58 DESIGNEDBUILDING CLASSIFICATION2020 MINNESOTA BUILDING CODE2020 MINNESOTA ACCESSIBILITY CODE(ICC/ANSI A117.1-2009 with MN Amendments)CHAPTER 3 USE AND OCCUPANCY CLASSIFICATIONSECTION 304 BUSINESS GROUP304.1 BUSINESS GROUP B. BUSINESS GROUP B OCCUPANCY INCLUDES, AMONG OTHERS, THE USE OF A BUILDING OR STRUCTURE, OR A PORTION THEREOF, FOR OFFICE OR SERVICE-TYPE TRANSACTIONS, INCLUDING STORAGE OF RECORDS AND ACCOUNTS:PROFESSIONAL SERVICESSECTION 311 STORAGE GROUP S311.3 LOW-HAZARD STORAGE, GROUP S-2. STORAGE GROUP S-2 OCCUPANCES INCLUDE, AMONG OTHERS, BUILDINGS USED FOR THE STORAGE OF NONCOMBUSTIBBLE MATERIALS SUCH AS PRODUCTS ON WOOD PALLETS OR IN PAPER CARTONS WITH OR WITHOUT SINGLE THINKESS DIVISIONS; OR IN PAPER WRAPPINGS. SUCH PRODUCTS ARE PERMITTED TO HAVE A NEGLIGIBLE AMOUNT OF PLASTIC TRIM, SUSH AS KNOBS, HANDLES OR FILM WRAPPING. GROUP S-2 STORAGE USES SHALL INCLUDE, BUT NOT BE LIMITED TO, STORAGE OF THE FOLLOWING:CEMENT IN BAGSGLASSGYPSUM BOARDMETAL PARTSMETALSOIL-FILLED AND OTHER TYPES OF DISTRIBUTON TRANSFORMERSPARKING GARAGES, OPEN OR ENCLOSEDCHAPTER 5 GENERAL BUILDING HEIGHTS AND AREASTABLE 504.4 ALLOWABLE NUMBER OF STORIES ABOVE GRADE PLANEB 3 STORIESS-2 3 STORIES1 STORY 21 FT HIGH DESIGNED7114 OFFICE (30%)16601 WAREHOUSE23715 TOTALTABLE 506.2 ALLOWABLE AREA FACTORBUSINESS GROUP B23000506.3.3 AMOUNT OF INCREASEIf=[F/P – 0.25] W/3028750=[346/692-0.25] 30/30LOW-HAZARD STORAGE GROUP S-226000506.3.3 AMOUNT OF INCREASEIf=[F/P – 0.25] W/3032500=[346/692-0.25] 30/30508.4.2 ALLOWABLE BUILDING AREA IN EACH STORY, THE BUILDING AREA SHALL BE SUCH THAT THE SUM OF THE RATIOS OF THE ACTUAL BUILDING AREA OF EACH SEPARATED OCCUPANCY DIVIDED BY THE ALLOWABLE BUILDING AREA OF EACH SEPARATED OCCUPANCY SHALL NOT EXCEED 1.7114/28750 + 16601/32500 = 0.76508.2.4 SEPARATION OF OCCUPANCIES. NO SEPARATION IS REQUIRED BETWEEN ACCESSORY OCCUPANCIES AND THE MAIN OCCUPANCY.CHAPTER 6 TYPE OF CONSTRUCTIONCONSTRUCTION TYPE IIB CHAPTER 9 FIRE PROTECTION SYSTEMSUNSPRINKLEDCHAPTER 10 MEANS OF EGRESSSECTION 1004.5 OCCUPANT LOADTABLE 1004.1.2 MAXIMUM FLOOR AREA ALLOWANCES PER OCCUPANT40 OFFICE/ 150 NET59 WAREHOUSE 300 SF GROSS99 TOTAL OCCUPANCYSECTION 1006 NUMBER OF EXITS AND EXIT ACCESS DOORWAYSTABLE 1006.2.1 EGRESS BASED ON OCCUPANT LOAD AND COMMON PATH OF EGRESS TRAVEL DISTANCE. TWO EXITS OR EXIT ACCESS DOORWAYS FROM ANY SPACE SHALL BE PROVIDED WHERE THE DESIGN OCCUPANT LOAD OR THE COMMON PATH OF EGRESS TRAVEL DISTANCE EXCEEDS THE VALUES LISTED IN TABLE 1006.2.1 (49 OCCUPANTS).1015.2.1 TWO EXITS OR EXIT ACCESS DOORWAYS. WHERE TWO EXITS OR EXIT ACCESS DOORWAYS ARE REQUIRED FROM ANY PORTION OF THE EXIT ACCESS, THE EXIT DOORS OR EXIT ACCESS DOORWAYS SHALL BE PLACED A DISTANCE APART EQUAL TO NOT LESS THAN ONE-HALF OF THE LENGTH OF THE MAXIMUM OVERALL DIAGONAL DIMENSION OF THE BUILDING OR AREA TO BE SERVED MEASURED IN A STRAIGHT LINE BETWEEN EXIT DOORS OR EXIT ACCESS DOORWAYS. CHAPTER 11 ACCESSIBILITYCHAPTER 29 PLUMBING SYSTEMSTABLE 2902.1 MINIMUM NUMBER OF REQUIRED PLUMBING FIXTURES(3) 1 PER 25 WATERCLOSETS FOR THE FIRST 50 AND 1 PER 50 FOR THE REMAINDER EXCEEDING 50.(3) LAVATORY 1 PER 40 FOR THE FIRST 80 AND 1 PER 80 FOR THE REMAINDER EXCEEDING 80.(1 ) SERVICE SINK/1001SITE PLANSCALE: 1"=20'-0"11LIST OF DRAWINGS1 SITE PLANL100 LANDSCAPE EXISTINGL200 LANDSCAPE PLANC1 SITE DEMOLITIONC2 SITE DIMENSIONSC3 GRADING & DRAINAGE PLANC4 EROSION CONTROL PLANC4A EROSION CONTROL PRIORC5 UTILITY PLANC6 DETAILS & SPECIFICATIONSC7 CITY DETAILSC8 CITY DETAILS2 FLOOR PLANS3 ELEVATIONS6,016 sq ftARKINGCES20 PASPAC2 EMPLOYEESABC12,004 sq ft20EXISTING TENANTEXISTINGTRECEIVED 3-14-22 R olf LokensgardArchitecture IncR olf LokensgardArchitecture IncRevisions:____________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________ALL CONTRACTORSANDSUBCONTRACTORS SHALL VERIFY ALLCONDITIONS AND DIMENSIONS AT THEBUILDING AND/OR SITE.3285 Terminal DriveEagan, MNI hereby certify that this plan, specificationor report was prepared by me or under mydirect supervision and that I am a dulyLicensed Architect under thelaws of the State of Minnesota._______________________________________Rolf LokensgardDate_____________Registration No.________AdditionTerminal Business CenterPreliminaryNot for construction3932 Stonebridge Dr N Suite 100St. Paul, Minnesota 55123651 452 3251www.rolflokensgard.comrolf@rolflokensgard.com8.31.2021 SCHEMATIC REVIEW2.16.2022 CUP SUBMITTALPlans and specifications are the property of Stanley& Wencl, LLC. No reproduction or sharing of thesedocuments is allowed without the express writtenpermission from an officer of Stanley & Wencl, LLC.0 100 20000300 feet300 feet31'-4"31'-4"31'-4"32'-0"32'-0"32'-0"20'-0"10'-0"19'-0"5'-0"20'-0" 18'-0" 25'-0" 10'-0"5'-0"28'-0"94'-0"124'-0"128'-0"32'-0"32'-0"32'-0"32'-0"10'-0"MIN10'-0"2'-0" 10'-0"1'-0"8'-0"8'-0" 8'-0" 8'-0"18'-9"26'-0"8'-0"18'-5" 19'-0"19'-0"18'-5 1/2"26'-0"36'-0"40'-8"20'-9"23431312,004 sq ft11,684 sq ft3,709 sq ft6,016 sq ft23 PARKINGSPACES20 YARDDUMPSTERRAMPRAMPNEW CONCRETE CURB AND GUTTERNEW CONCRETE CURB AND GUTTER6 FT CHAIN LINK FENCEWITH MESH PER C.U.P.NEW BITUMINOUS EXISTING BITUMINOUSTERMINAL DRIVESUN DRIVENEW BITUMINOUS EXISTING BITUMINOUSNEWCONCRETECURB ANDGUTTERSTORAGE BOX2TRUCK STORAGE AT NIGHTPARKING DURING DAY53331823CONC APRONTRUCK STORAGE AT NIGHT10 PARKING 20 A OWNER 2 B 2 EMPLOYEES 30 C-G 30 EMPLOYEES 12 VISITORS 64 TOTAL 35 23 17 TRUCK PROOF OF PARKING 75 TOTAL DESIGNED 67 TOTAL REQUIRED BY ZONINGHOURS OF OPERATON 7 AM TO 5 PM2030 EMPLOYEES55 PARKING SPACES2 EMPLOYEES20 PARKINGSPACESABCDEFG881ELECTRICELECTRICELECTRIC6789DCBA43215NEW TENANTEXISTING TENANTEXISTINGSITE DATALOT 3, BLOCK 1, TAN ME INDUSTRIAL PARK, DAKOTA COUNTY, MINNESOTALOT AREA: 94,443 SF 2.17 ACRES94443 – 4092 Sun Drive = 90351ZONING AND LAND USE: I-2 LIGHT INDUSTRIALMIN BUILDING SETBACKS40’-0” SETBACK FROM PUBLIC RIGHT-OF-WAY20’-0” SIDE YARD SETBACK20’-0” REAR YARD SETBACK40’-0” STRUCTURE HEIGHT MAX. 21 FT DESIGNED.50’-0” Building and outdoor storage setback adjacent to properties guided* for residential or public use when properties are separated by a street, or when directly abutting property guided by Park and Public Facilities.35% BUILDING COVERAGE MAX 25% DESIGNED1.65 ACRES = (75%) IMPERVIOUS AREA 1.56 ACRES = (72%) IMPERVIOUS AREA EXCLUDING SUN DRIVE.25% GREEN SPACE REQUIRED28.1% DESIGNEDPARKING12004 SF PHASE I11684 SF PHASE II23,688 SF TOTAL5922 TOTAL OFFICE (25%)40 5922/15017766 TOTAL WAREHOUSE15 6000/40012 11759/100067 TOTAL PARKING SPACES REQUIRED75 DESIGNEDBUILDING CLASSIFICATION2020 MINNESOTA BUILDING CODE2020 MINNESOTA ACCESSIBILITY CODE(ICC/ANSI A117.1-2009 with MN Amendments)CHAPTER 3 USE AND OCCUPANCY CLASSIFICATIONSECTION 304 BUSINESS GROUP304.1 BUSINESS GROUP B. BUSINESS GROUP B OCCUPANCY INCLUDES, AMONG OTHERS, THE USE OF A BUILDING OR STRUCTURE, OR A PORTION THEREOF, FOR OFFICE OR SERVICE-TYPE TRANSACTIONS, INCLUDING STORAGE OF RECORDS AND ACCOUNTS:PROFESSIONAL SERVICESSECTION 311 STORAGE GROUP S311.3 LOW-HAZARD STORAGE, GROUP S-2. STORAGE GROUP S-2 OCCUPANCES INCLUDE, AMONG OTHERS, BUILDINGS USED FOR THE STORAGE OF NONCOMBUSTIBBLE MATERIALS SUCH AS PRODUCTS ON WOOD PALLETS OR IN PAPER CARTONS WITH OR WITHOUT SINGLE THINKESS DIVISIONS; OR IN PAPER WRAPPINGS. SUCH PRODUCTS ARE PERMITTED TO HAVE A NEGLIGIBLE AMOUNT OF PLASTIC TRIM, SUSH AS KNOBS, HANDLES OR FILM WRAPPING. GROUP S-2 STORAGE USES SHALL INCLUDE, BUT NOT BE LIMITED TO, STORAGE OF THE FOLLOWING:CEMENT IN BAGSGLASSGYPSUM BOARDMETAL PARTSMETALSOIL-FILLED AND OTHER TYPES OF DISTRIBUTON TRANSFORMERSPARKING GARAGES, OPEN OR ENCLOSEDCHAPTER 5 GENERAL BUILDING HEIGHTS AND AREASTABLE 504.4 ALLOWABLE NUMBER OF STORIES ABOVE GRADE PLANEB 3 STORIESS-2 3 STORIES1 STORY 21 FT HIGH DESIGNED7114 OFFICE (30%)16601 WAREHOUSE23715 TOTALTABLE 506.2 ALLOWABLE AREA FACTORBUSINESS GROUP B23000506.3.3 AMOUNT OF INCREASEIf=[F/P – 0.25] W/3028750=[346/692-0.25] 30/30LOW-HAZARD STORAGE GROUP S-226000506.3.3 AMOUNT OF INCREASEIf=[F/P – 0.25] W/3032500=[346/692-0.25] 30/30508.4.2 ALLOWABLE BUILDING AREA IN EACH STORY, THE BUILDING AREA SHALL BE SUCH THAT THE SUM OF THE RATIOS OF THE ACTUAL BUILDING AREA OF EACH SEPARATED OCCUPANCY DIVIDED BY THE ALLOWABLE BUILDING AREA OF EACH SEPARATED OCCUPANCY SHALL NOT EXCEED 1.7114/28750 + 16601/32500 = 0.76508.2.4 SEPARATION OF OCCUPANCIES. NO SEPARATION IS REQUIRED BETWEEN ACCESSORY OCCUPANCIES AND THE MAIN OCCUPANCY.CHAPTER 6 TYPE OF CONSTRUCTIONCONSTRUCTION TYPE IIB CHAPTER 9 FIRE PROTECTION SYSTEMSUNSPRINKLEDCHAPTER 10 MEANS OF EGRESSSECTION 1004.5 OCCUPANT LOADTABLE 1004.1.2 MAXIMUM FLOOR AREA ALLOWANCES PER OCCUPANT40 OFFICE/ 150 NET59 WAREHOUSE 300 SF GROSS99 TOTAL OCCUPANCYSECTION 1006 NUMBER OF EXITS AND EXIT ACCESS DOORWAYSTABLE 1006.2.1 EGRESS BASED ON OCCUPANT LOAD AND COMMON PATH OF EGRESS TRAVEL DISTANCE. TWO EXITS OR EXIT ACCESS DOORWAYS FROM ANY SPACE SHALL BE PROVIDED WHERE THE DESIGN OCCUPANT LOAD OR THE COMMON PATH OF EGRESS TRAVEL DISTANCE EXCEEDS THE VALUES LISTED IN TABLE 1006.2.1 (49 OCCUPANTS).1015.2.1 TWO EXITS OR EXIT ACCESS DOORWAYS. WHERE TWO EXITS OR EXIT ACCESS DOORWAYS ARE REQUIRED FROM ANY PORTION OF THE EXIT ACCESS, THE EXIT DOORS OR EXIT ACCESS DOORWAYS SHALL BE PLACED A DISTANCE APART EQUAL TO NOT LESS THAN ONE-HALF OF THE LENGTH OF THE MAXIMUM OVERALL DIAGONAL DIMENSION OF THE BUILDING OR AREA TO BE SERVED MEASURED IN A STRAIGHT LINE BETWEEN EXIT DOORS OR EXIT ACCESS DOORWAYS. CHAPTER 11 ACCESSIBILITYCHAPTER 29 PLUMBING SYSTEMSTABLE 2902.1 MINIMUM NUMBER OF REQUIRED PLUMBING FIXTURES(3) 1 PER 25 WATERCLOSETS FOR THE FIRST 50 AND 1 PER 50 FOR THE REMAINDER EXCEEDING 50.(3) LAVATORY 1 PER 40 FOR THE FIRST 80 AND 1 PER 80 FOR THE REMAINDER EXCEEDING 80.(1 ) SERVICE SINK/1001SITE PLANSCALE: 1"=20'-0"11LIST OF DRAWINGS1 SITE PLANL100 LANDSCAPE EXISTINGL200 LANDSCAPE PLANC1 SITE DEMOLITIONC2 SITE DIMENSIONSC3 GRADING & DRAINAGE PLANC4 EROSION CONTROL PLANC4A EROSION CONTROL PRIORC5 UTILITY PLANC6 DETAILS & SPECIFICATIONSC7 CITY DETAILSC8 CITY DETAILS2 FLOOR PLANS3 ELEVATIONS6,016 sq ftARKINGCES20 PASPAC2 EMPLOYEESABC12,004 sq ft20EXISTING TENANTEXISTINGTRECEIVED 3-8-22 5(029( 67803675$352&.$1'('*,1*)$%5,&5(029((;7*)(1&(5(029((;7*678033581((;7* 0$3/(6 3,1(725(0$,1 -81,3(56725(0$,1680$&72%(5(029('7(50,1$/'5($*$101 $0850$3/(6725(0$,15(029( 6+58%68WLOLW\(DVHPHQWSHU7$10(,1'8675,$/3$5.8WLOLW\(DVHPHQWSHU7$10(,1'8675,$/3$5. 'UDLQDJHDQG8WLOLW\(DVHPHQWSHU7$10(,1'8675,$/3$5.'UDLQDJHDQG8WLOLW\(DVHPHQWSHU7$10(,1'8675,$/3$5.'UDLQDJHDQG8WLOLW\(DVHPHQW SHU7$10(,1'8675,$/3$5. 3,1(672%(5(029('5(029( $0850$3/(6 3,1(72%(5(029(' 3,1(725(0$,1 0$3/(72%(5(029('5(029((;7*)(1&( 3,1(72%(5(029('7(50,1$/5'($*$101$5&+,7(&7 52/)/2.(16*$5'UROI#UROIORNHQVJDUGFRP)255(9,(:4XDOLILFDWLRQ 7KLVHOHFWURQLFGUDZLQJ &$' ILOHZDVSUHSDUHGE\%(/$1'6&$3('(6,*16IRUWKLVSURMHFWDQGLVDQ,QVWUXPHQWRI6HUYLFHRZQHGE\%(/$1'6&$3('(6,*16DQGWREHXVHGVROHO\ZLWKUHVSHFWWRWKLVSURMHFW7KLVHOHFWURQLFGUDZLQJ &$' ILOHVKDOOQRWEHXVHGRQRWKHUSURMHFWVIRUDGGLWLRQVWRWKLVSURMHFWRUIRUFRPSOHWLRQRIWKLVSURMHFWE\RWKHUVZLWKRXWZULWWHQDSSURYDOE\%(/$1'6&$3('(6,*167KLVGUDZLQJVKDOOEHXVHGIRULQIRUPDWLRQDQGUHIHUHQFHRQO\$OOLQWHQWLRQDORUXQLQWHQWLRQDOUHYLVLRQVDGGLWLRQVRUGHOHWLRQVWRWKHVH&$'ILOHVVKDOOEHPDGHDWWKHIXOOULVNRIWKDWSDUW\PDNLQJVXFKUHYLVLRQVDGGLWLRQVRUGHOHWLRQVDQGWKDWSDUW\VKDOOLQGHPQLI\KROGKDUPOHVVDQGGHIHQG%(/$1'6&$3('(6,*16IURPDQ\ DOOUHVSRQVLELOLWLHVFODLPVDQGOLDELOLWLHV/5(029$/6 75((35(6(59$7,213/$15(029$/675((35(6(59$7,213/$16&$/( 127(6 $//75((3527(&7,21)(1&,1*$1'(526,21&21752/)(1&,1*6+$//%(,167$//('$&&25',1*727+(3/$1635,2572$1<'(02/,7,21$)7(5'(02/,7,2125$61(&(66$5<75((3527(&7,21)(1&,1*0$<%(5(/2&$7(':,7+$33529$/)5207+(/$1'6&$3($5&+,7(&7$//75((3527(&7,21)(1&,1*$1'(526,21&21752/'(9,&(66+$//%(0$,17$,1(')257+('85$7,212)7+(&216758&7,213(5,2' &2175$&7256+$//1276725($1<0$7(5,$/6253$5.$1<9(+,&/(6,175((3527(&7,21=21(67+()(1&(6+$//35(9(1775$)),&029(0(17$1'7+(3/$&(0(172)7(0325$5<)$&,/,7,(6(48,30(17672&.3,/(6$1'6833/,(6)520+$50,1*9(*(7$7,21:,7+,17+(/,0,762)3527(&7,21 7+(&2175$&7256+$//&/($1/<&87$//52276(;326('%<*5$',1*$6',5(&7('%<7+(/$1'6&$3($5&+,7(&7 7+(&2175$&7256+$//86('(6,*1$7('&216758&7,21(175$1&(6$1'67$*,1*$5($6 75((3527(&7,21)(1&,1*72%(5(029('%<63+$32676 8&+$11(//%6)227675(1*7+3$,17('25*$/9$1,=(')(1&( 25$1*(3/$67,&&216758&7,21)(1&(25$33529('(48$/67((/)(1&(3267625$1*(3/$67,&&216758&7,21)(1&,1*25$33529('(48$/'$5.6+5(''('+$5':22'08/&+'(37+ +*73/$19,(:$;219,(:&5($7(63$'('('*($5281'75((72&217$,108/&+5(029(62'$5281'75((86(%('('*(56(('(7$,//)$67(1)(1&(7232676:,7+3/$67,&=,37,(6 3(532670,1'(37+75((3527(&7,21'(7$,/6&$/( 176 8WLOLW\(DVHPHQWSHU7$10(,1'8675,$/3$5.8WLOLW\(DVHPHQWSHU7$10(,1'8675,$/3$5. 'UDLQDJHDQG8WLOLW\(DVHPHQWSHU7$10(,1'8675,$/3$5.'UDLQDJHDQG8WLOLW\(DVHPHQWSHU7$10(,1'8675,$/3$5.'UDLQDJHDQG8WLOLW\(DVHPHQW SHU7$10(,1'8675,$/3$5.8WLOLW\(DVHPHQWSHU7$10(,1'8675,$/3$5.8WLOLW\(DVHPHQWSHU7$10(,1'8675,$/3$5.d ZD/E>Z/s ^hEZ/s WZKWK ^ h/ > / E ' / d/ K E && с ϳ ϲ ϰ͘ ϱ :%,QWHUVWDWH6HPL7UDLOHU QW 5. Q 5 WZKWK ^ h/>/E' / d/ K E && с ϳ ϲ ϰ͘ ϱ 1(:%/'*$'',7,21$/$$$$$$$/$$$$$$.3$5.3$5.3$5.6767676767677677777676767677666676766670111111 01111111111110111111111111111111111111110(,1 66666'886666666886660(,1 66686'8666666686 %,5&+ :+,7(63,5( +*7&/803 -81,3(5 *5(<2:/ 63,5($ 725 -81,3(5 *5(<2:/ 63,5($ 725 08*23,1( -$&2%621 08*23,1( -$&2%621 08*23,1( -$&2%621 &/(0$7,69,1(675$,1('72:$// -81,3(5 *5(<2:/ 63,5($ 725 63,5($ 725 +<'5$1*($ /,0(/,*+7 &217 '$</,/< -2$16(1,25 &$70,17 :$/.(56/2: )255(9,(:4XDOLILFDWLRQ 7KLVHOHFWURQLFGUDZLQJ &$' ILOHZDVSUHSDUHGE\%(/$1'6&$3('(6,*16IRUWKLVSURMHFWDQGLVDQ,QVWUXPHQWRI6HUYLFHRZQHGE\%(/$1'6&$3('(6,*16DQGWREHXVHGVROHO\ZLWKUHVSHFWWRWKLVSURMHFW7KLVHOHFWURQLFGUDZLQJ &$' ILOHVKDOOQRWEHXVHGRQRWKHUSURMHFWVIRUDGGLWLRQVWRWKLVSURMHFWRUIRUFRPSOHWLRQRIWKLVSURMHFWE\RWKHUVZLWKRXWZULWWHQDSSURYDOE\%(/$1'6&$3('(6,*167KLVGUDZLQJVKDOOEHXVHGIRULQIRUPDWLRQDQGUHIHUHQFHRQO\$OOLQWHQWLRQDORUXQLQWHQWLRQDOUHYLVLRQVDGGLWLRQVRUGHOHWLRQVWRWKHVH&$'ILOHVVKDOOEHPDGHDWWKHIXOOULVNRIWKDWSDUW\PDNLQJVXFKUHYLVLRQVDGGLWLRQVRUGHOHWLRQVDQGWKDWSDUW\VKDOOLQGHPQLI\KROGKDUPOHVVDQGGHIHQG%(/$1'6&$3('(6,*16IURPDQ\ DOOUHVSRQVLELOLWLHVFODLPVDQGOLDELOLWLHV//$1'6&$3(3/$167$.,1* *8<$66(0%/<1270$1'$725<%87&2175$&7256+$//0$,17$,175((,1$3/80%326,7,21)257+('85$7,212)7+(21(<($5*8$5$17((3(5,2'*8<$66(0%/< 32/<3523</(1(2532/<(7+</(1( 0,/ :,'(675,3 7<3 '28%/(675$1'*$:,5( 67((/67$.(6256,*132676#'(*2& 6((67$.,1*',$*5$0 &225',1$7(67$.,1*72,1685(81,)25025,(17$7,212)*8</,1(6$1'67$.(6'(*'(*'(*127(6 &2175$&7256+$///2&$7(:,7+3,17+(5227)/$5(2)($&+75((35,2572',**,1*7+(3/$17,1*3,7 7+()/$5(,67+(75$16,7,21=21(%(7:((17+(0$,167(0$1'7+(52276<67(0 5(029(62,/)5207232)5227%$//72(;326(7232))/$5(75((6:,7+025(7+$12)(;&(6662,/$%29(7+()/$5(:,//%(5(-(&7('0($685(',67$1&(%(7:((1)/$5($1'%277202)5227%$//68%75$&772'(7(50,1('(37+2)3/$17,1*3,7 ',*3,772'(37+'(7(50,1('$%29(3,76+$//%(',6+(':,7+6,'(:$//6$66+2:1%(/2:6&$5,)<:$//6$1'%277202)3,7 6(775((,13,7627+$7)/$5(,621(7:2,1&+(6$%29(6855281',1**5$'( ,1$//$5($6:,7++($9<&/$<253225/<'5$,1('62,/6 0277/,1* &217$&7/$1'6&$3($5&+,7(&775((0$<%(5(/2&$7('255227%$//)857+(5(/(9$7('75((6:,7+%(5(-(&7(')257+()2//2:,1*5($6216 3225)250'$0$*('7581.%85,('5227)/$5(6(1&,5&/,1*75$1632575227681&2162/,'$7('5227%$//62,/ '8(72(;&(66,9(+$1'/,1* /$1'6&$3(&2175$&7256+$//6&+('8/(,163(&7,21%<7+(/$1'6&$3($5&+,7(&7+285635,25723/$&,1*08/&+$5281'7+(75((3/$17,1*6$)7(56(77,1*5227%$//,13,7%$&.),//72:,7+,12)7232)5227%$//$1'6$785$7(:,7+:$7(5&87$1'5(029(72%$&.),///,1($//7:,1(:,5($1'25%85/$3%$&.),//817,/3,7,6)8//:$7(5$*$,1%$&.),//:,7+1$7,9(62,/6$1'3/$17,1*62,/0,;7+2528*+/<6((63(& '$5. 6+5(''('+$5':22'08/&+'(37+;)7',$0(7(538//$:$<)5207581.2)75((52'(177581.3527(&7,21 &2558*$7('32/<(7+<(1('5$,1$*(3,3(6/,79(57,&$//<25+$5':,5(&/27+0(6+&</,1'(5',0(16,216 ',$0(7(5 25*5($7(5 ;+*76((63(&,),&$7,21$)7(5,167$//$7,2175,0287'($':22'$1'25'()250('7:,*6'2127&87/($'(567$.(6$1'*8<:,5(66((127(6%(/2:)/$5(6(7$7$%29(6855281',1**5$'(6((127($%29(',6+3/$17,1*3,76&$5,)<%27720$1'6,'(62)3,781',6785%('62,/25&203$&7('68%*5$'(67$.,1*',$*5$0;UHI ? ' ( 7 $ , / 6 ? % ( ' ( ' * , 1 * 0 $ & + , 1 ( ' ( 7 $ , / G Z J 352326('/$1'6&$3(3/$16&$/( 7(50,1$/5'($*$101$5&+,7(&7 52/)/2.(16*$5'UROI#UROIORNHQVJDUGFRP75((3/$17,1*'(7$,/6&$/( 176$OOTXDQWLWLHVVKDSHVRIEHGVDQGORFDWLRQVVKDOOEHYHULILHGDQGDGMXVWHGDVUHTXLUHGWRFRQIRUPWRWKHH[DFWFRQGLWLRQVRIWKHVLWH5HYLHZZLWKODQGVFDSHDUFKLWHFWSULRUWRGLJJLQJ/RFDWHDOOXWLOLWLHVLQFOXGLQJLUULJDWLRQOLQHVZLWKWKH2ZQHU1RWLI\WKH/DQGVFDSH$UFKLWHFWRIDQ\FRQIOLFWVWRIDFLOLWDWHSODQWUHORFDWLRQ&RQWUDFWRUVKDOOEHUHVSRQVLEOHIRUWKHUHSDLURIDQ\GDPDJHVWRVDPH7KH&RQWUDFWRUVKDOOEHUHVSRQVLEOHIRUFRPSO\LQJZLWKDOODSSOLFDEOHFRGHVUHJXODWLRQVDQGSHUPLWVJRYHUQLQJWKHZRUN7KH&RQWUDFWRUVKDOOEHUHVSRQVLEOHIRUDOOPXOFKHVDQGSODQWLQJVRLOTXDQWLWLHVWRFRPSOHWHWKHZRUNVKRZQRQWKHSODQ9HULI\DOOTXDQWLWLHVVKRZQRQWKHSODQWVFKHGXOH7KH&RQWUDFWRUVKDOOUHPRYHIURPWKHVLWHDOOVRGWXUIZKLFKKDVEHHQUHPRYHGIRUQHZSODQWEHGV/RQJWHUPVWRUDJHRIPDWHULDOVRUVXSSOLHVRQVLWHZLOOQRWEHDOORZHG$Q\SODQWVWRFNQRWSODQWHGRQGD\RIGHOLYHU\VKDOOEHKHHOHGLQDQGZDWHUHGXQWLOLQVWDOODWLRQ3ODQWVQRWPDLQWDLQHGLQWKLVPDQQHUZLOOEHUHMHFWHG7KH&RQWUDFWRUVKDOONHHSSDYHPHQWVSODQWHUVDQGEXLOGLQJVFOHDQDQGXQVWDLQHG$OOZDVWHVKDOOEHSURPSWO\UHPRYHGIURPWKHVLWH$Q\GDPDJHWRH[LVWLQJIDFLOLWLHVVKDOOEHUHSDLUHGDWWKH&RQWUDFWRU VH[SHQVH7KHSODQWDNHVSUHFHGHQFHRYHUWKHSODQWVFKHGXOHLIGLVFUHSHQFLHVH[LVW7KHVSHFLILFDWLRQVWDNHSUHFHGHQFHRYHUWKHSODQWLQJQRWHVDQGJHQHUDOQRWHV$PHQGS+RIEHGZLWK,URQ6XOIDWH 1RVXEVWLWXWLRQVRISODQWPDWHULDOVVKDOOEHDFFHSWHGXQOHVVDSSURYHGLQZULWLQJE\WKHODQGVFDSHDUFKLWHFW$OOSODQWLQJVWRFNVKDOOFRQIRUPWRWKH $PHULFDQ6WDQGDUGIRU1XUVHU\6WRFN $16,ODWHVWHGLWLRQRIWKH$PHULFDQ$VVRFLDWLRQRI1XUVHU\PHQ,QF$OOSODQWVVKDOOEHJXDUDQWHHGIRU21(<($5IURPWKHGDWHRIVXEVWDQWLDOFRPSOHWLRQXQOHVVRWKHUZLVHVSHFLILHG7KHJXDUDQWHHVKDOOFRYHUWKHIXOOFRVWRIUHSODFHPHQWLQFOXGLQJODERUDQGSODQWV6HDVRQV7LPHRI3ODQWLQJ 6SULQJ $SULOWK-XQHWK)DOO $XJXVWWK1RYWK1RWH 7KH&RQWUDFWRUPD\HOHFWWRSODQWLQWKHRIIVHDVRQVHQWLUHO\DWKLVKHUULVN3ODQWLQJVRLOIRUWUHHDQGVKUXESLWV %\YROXPHPL[QDWLYHVRLOVZLWKLPSRUWHGSODQWLQJVRLOV6HHVSHFV3ODQWLQJVRLOIRUVKUXEDQGSHUHQQLDOEHGV7KRURXJKO\PL[HGLQHTXDOSDUWVE\YROXPHDPHQGHGWRSVRLOZDVKHGVDQGSHDWRURUJDQLFFRPSRVW6HHVSHFV)UDFWXUHDOOFRPSDFWHGVRLOV6HH6RLO'HFRPSDFWLRQ1RWHV,UULJDWLRQV\VWHPLIVSHFLILHGVKDOOEHIXOO\RSHUDWLRQDODQGWHVWHGDWWKHWLPHRISODQWLQJ'XULQJILUVWVHDVRQFRQWUDFWRUVKDOOPRQLWRUPRLVWXUHFRQGLWLRQVDQGDGMXVWLUULJDWLRQDVQHHGHGWRDYRLGRYHUDQGXQGHUZDWHULQJRISODQWPDWHULDOVGXULQJHVWDEOLVKPHQW0XOFK '$5.'RXEOHVKUHGGHGKDUGZRRGPXOFKFOHDQDQGIUHHRIQR[LRXVZHHGVVRLODQGRWKHUGHOHWHULRXVPDWHULDO8VHIRUDOOWUHHSODQWLQJVDQGRYHUDOOSODQWLQJEHGVIRUVKUXEVDQGSHUHQQLDOV'HOLYHUPXOFKRQSODQWLQJGD\DQGPXOFKDOOPDWHULDOZLWKLQKRXUVRILQVWDOODWLRQ8VHWKHIROORZLQJGHSWKV LQFKHVIRUWUHHVLQFKHVIRUVKUXEVLQFKHVIRUSHUHQQLDOV38//08/&+$:$<)5207+(7581.6$1'67(062)$//3/$170$7(5,$/0DLQWHQDQFHVKDOOEHJLQLPPHGLDWHO\DIWHUHDFKSRUWLRQRIWKHZRUNLVLQSODFH3ODQWPDWHULDOVVKDOOEHSURWHFWHGDQGPDLQWDLQHGXQWLOWKHLQVWDOODWLRQRIDOOSODQWVLVFRPSOHWHLQVSHFWLRQKDVEHHQPDGHDQGWKHSODQWLQJDFFHSWHGH[FOXVLYHRIWKHJXDUDQWHH0DLQWHQDQFHVKDOOLQFOXGHZDWHULQJFXOWLYDWLQJPXOFKLQJSUXQLQJDQGUHPRYDORIGHDGPDWHULDODQGNHHSLQJWKHSODQWVLQDSOXPESRVLWLRQ$IWHUDFFHSWDQFHWKH2ZQHUVKDOODVVXPHPDLQWHQDQFHUHVSRQVLELOLWLHV7KH&RQWUDFWRUVKDOOPDLQWDLQDOOPDWHULDOVLQDSOXPESRVLWLRQIRUWKHGXUDWLRQRIWKHJXDUDQWHHSHULRG 7KH&RQWUDFWRUVKDOOUHTXHVWLQZULWLQJDILQDODFFHSWDQFHLQVSHFWLRQ*HRWH[WLOHIDEULFVKDOOQRWEHXVHGXQGHUPXOFK6KUXEDQGSHUHQQLDOEHGVKDOOKDYHVSDGHGHGJHVXQOHVVSODQVLQGLFDWHRWKHUZLVH3/$17,1*127(66&$/( 176 R olf LokensgardArchitecture IncR olf LokensgardArchitecture IncRevisions:____________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________ALL CONTRACTORSANDSUBCONTRACTORS SHALL VERIFY ALLCONDITIONS AND DIMENSIONS AT THEBUILDING AND/OR SITE.3285 Terminal DriveEagan, MNI hereby certify that this plan, specificationor report was prepared by me or under mydirect supervision and that I am a dulyLicensed Architect under thelaws of the State of Minnesota._______________________________________Rolf LokensgardDate_____________Registration No.________AdditionTerminal Business CenterPreliminaryNot for construction3932 Stonebridge Dr N Suite 100St. Paul, Minnesota 55123651 452 3251www.rolflokensgard.comrolf@rolflokensgard.com8.31.2021 SCHEMATIC REVIEW2.16.2022 CUP REVIEWPlans and specifications are the property of Stanley& Wencl, LLC. No reproduction or sharing of thesedocuments is allowed without the express writtenpermission from an officer of Stanley & Wencl, LLC.31'-4" 31'-4" 31'-4"32'-0" 32'-0" 32'-0"20'-0"28'-0"94'-0"124'-0"2'-0" 10'-0" 1'-0" 8'-0"11,684 sq ftADDITIONRAMP6789DCBA52ADDITION FLOOR PLAN12 R olf LokensgardArchitecture IncR olf LokensgardArchitecture IncRevisions:____________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________ALL CONTRACTORSANDSUBCONTRACTORS SHALL VERIFY ALLCONDITIONS AND DIMENSIONS AT THEBUILDING AND/OR SITE.3285 Terminal DriveEagan, MNI hereby certify that this plan, specificationor report was prepared by me or under mydirect supervision and that I am a dulyLicensed Architect under thelaws of the State of Minnesota._______________________________________Rolf LokensgardDate_____________Registration No.________AdditionTerminal Business CenterPreliminaryNot for construction3932 Stonebridge Dr N Suite 100St. Paul, Minnesota 55123651 452 3251www.rolflokensgard.comrolf@rolflokensgard.com8.31.2021 SCHEMATIC REVIEW2.16.2022 CUP SUBMITTALPlans and specifications are the property of Stanley& Wencl, LLC. No reproduction or sharing of thesedocuments is allowed without the express writtenpermission from an officer of Stanley & Wencl, LLC.ABCD8'-1/2"8'-1/2"32'-0" 32'-0"32'-0"128'-0"32'-0" 32'-0" 32'-0" 32'-0"28'-0"31'-4" 31'-4" 31'-4"8'-1/2"20'-4"20'-4"124'-0"94'-0"abcdef3285PRECAST PANELS TO MATCHEXISTING TEXTURE,PATTERN, AND COLORTCHLIGHTS67894321D5556677112334889464'-0" 64'-0" 32'-0" 32'-0" 32'-0"28'-0"8'-1/2"20'-4"128'-0"124'-0"2'-0"10'-0"1'-0"8'-0"PRECAST PANELS TO MATCHEXISTING TEXTURE,PATTERN, AND COLORLIGHTS31'-4" 31'-4" 31'-4"32'-0" 32'-0" 32'-0"20'-0"10'-0"28'-0"94'-0"124'-0"128'-0"32'-0" 32'-0" 32'-0" 32'-0"2'-0" 10'-0" 1'-0"8'-0"12,004 sq ft11,684 sq ft36,016 sq ftADDITION EXISTINGRAMPRAMPUN DRIVE6789DCBA43215:3/('11HHGKHOS"7HFKKHOSOLQH (PDLO FXVWVHUY#UDEOLJKWLQJFRP:HEVLWH ZZZUDEOLJKWLQJFRP&RS\ULJKWc5$%/LJKWLQJ$OO5LJKWV5HVHUYHG1RWH 6SHFLeFDWLRQVDUHVXEMHFWWRFKDQJHDWDQ\WLPHZLWKRXWQRWLFH3DJHRI8OWUDKLJKHfFLHQF\/(':DWWZDOOSDFNSDWHQWSHQGLQJWKHUPDOPDQDJHPHQWV\VWHPKRXU/OLIHVSDQ\HDUQRFRPSURPLVHZDUUDQW\&RORU %URQ]H :HLJKW OEV3URMHFW 7\SH 3UHSDUHG%\ 'DWH 'ULYHU,QIR7\SH &RQVWDQW&XUUHQW9 $9 $9 $9 $,QSXW:DWWV :/(',QIR:DWWV :&RORU7HPS . 1HXWUDO &RORU$FFXUDF\ &5,//LIHVSDQ +RXUV/XPHQV (fFDF\ OP:7HFKQLFDO6SHFLbFDWLRQV&RPSOLDQFH8//LVWHG 6XLWDEOHIRUZHWORFDWLRQV'/&/LVWHG 7KLVSURGXFWLVRQWKH'HVLJQ/LJKWV&RQVRUWLXP '/& 4XDOLeHG3URGXFWV/LVWDQGLVHOLJLEOHIRUUHEDWHVIURP'/&0HPEHU8WLOLWLHV'/&3URGXFW&RGH 3 ,(61$/0 /07HVWLQJ 5$%/('OXPLQDLUHVDQG/('FRPSRQHQWVKDYHEHHQWHVWHGE\DQLQGHSHQGHQWODERUDWRU\LQDFFRUGDQFHZLWK,(61$/0 DQG/03HUIRUPDQFH/LIHVSDQ +RXU/('OLIHVSDQEDVHGRQ,(6/0UHVXOWVDQG70FDOFXODWLRQV/('&KDUDFWHULVWLFV/(' 0XOWLFKLSKLJKRXWSXWORQJOLIH/('&RORU&RQVLVWHQF\ VWHS0DF$GDP(OOLSVHELQQLQJWRDFKLHYHFRQVLVWHQWe[WXUHWRe[WXUHFRORU&RORU6WDELOLW\ /('FRORUWHPSHUDWXUHLVZDUUDQWLHGWRVKLIWQRPRUHWKDQ.LQFRORUWHPSHUDWXUHRYHUD\HDUSHULRG&RORU8QLIRUPLW\ 5$% VUDQJHRI&RUUHODWHG&RORU7HPSHUDWXUHIROORZVWKHJXLGHOLQHVRIWKH$PHULFDQ1DWLRQDO6WDQGDUGIRU6SHFLeFDWLRQVIRUWKH&KURPDWLFLW\RI6ROLG6WDWH/LJKWLQJ 66/ 3URGXFWV$16,&&RQVWUXFWLRQ0D[LPXP$PELHQW7HPSHUDWXUH 6XLWDEOHIRUXVHLQXSWRd& d) &ROG:HDWKHU6WDUWLQJ 0LQLPXPVWDUWLQJWHPSHUDWXUHLVd& d) 7KHUPDO0DQDJHPHQW 6XSHULRUKHDWVLQNLQJZLWKH[WHUQDO$LU)ORZeQV)LQLVK 2XUHQYLURQPHQWDOO\IULHQGO\SRO\HVWHUSRZGHUFRDWLQJVDUHIRUPXODWHGIRUKLJKGXUDELOLW\DQGORQJODVWLQJFRORU5HcHFWRU 6HPLVSHFXODUYDFXXPPHWDOL]HGSRO\FDUERQDWH*DVNHWV +LJKWHPSHUDWXUHVLOLFRQHJDVNHWV3WEST ELEVATION SOUTH ELEVATIONNORTH ELEVATIONSCALE: 1/16" = 1'-0"SCALE: 1/16" = 1'-0"SCALE: 1/16" = 1'-0"132343BUILDING FLOOR PLANSCALE: 1/16" = 1'-0"63EXISTING PHOTO3353TYPICAL LUMENAIRE